KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_1613Help
Entry
ECO103_1613       CDS       T01096                                 

Gene name
ddpD
Definition
(GenBank) D-ala-D-ala transporter subunit DdpD
  KO
K02031  peptide/nickel transport system ATP-binding protein
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECO103_1613 (ddpD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eoh02000]
    ECO103_1613 (ddpD)
Transporters [BR:eoh02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    ECO103_1613 (ddpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran oligo_HPY AAA_21 SMC_N AAA_16 AAA_5 AAA_29 AAA_22 AAA_33 AAA_7
Motif
Other DBs
NCBI-ProteinID: BAI30435
LinkDB All DBs
Position
complement(1705396..1706382)
Genome map
AA seq 328 aa AA seqDB search
MTQPVLDIQQLHLSFPGFNGDVHALNNVSLQINRGEIVGLVGESGSGKSVTAMLIMRLLQ
TGSYCVHRGQISLLGDDVLNAREKQLRQWRGARVAMIFQEPMTALNPTRRIGLQMMDVIR
HHQPISRREARAKAIALLEEMQIPDAVEVMSRYPFELSGGMRQRVMIALAFSCEPQLIIA
DEPTTALDVTLQLQLLRLLKHKARASGTAVLFISHDMVVVSQLCDSVYVMYAGSVIESGV
TADIIHHPRHPYTIGLLQCAPEHGVPRQPLPAIPGTVPNLTHLPEGCAFRDRCYAAGAQC
ENVPALTACGDNNQRCACWYPQQEVISV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgacccaacccgttctggacattcaacagctgcatttgagtttccccggttttaacggt
gatgttcacgcgctcaacaatgtgtccttgcagattaaccgcggcgaaattgtcggtctg
gtgggagaatccggctcaggtaaatcagtcaccgcaatgctgattatgcgtctgctacag
acgggcagttattgcgtacatcgggggcagatttcactgctgggagacgatgttcttaac
gctcgggaaaaacagcttcgtcagtggcgcggcgcacgagtggcgatgatctttcaggaa
ccgatgaccgccctcaatccgacacgtcgaataggtcttcagatgatggacgtgatccgc
catcatcaaccaataagtcgtcgggaagccagagctaaagcgattgccctgctggaagag
atgcaaatcccggatgccgtggaagttatgtcgcgctatccgtttgagctttcaggtggt
atgcgccagcgggtaatgattgcgctggcattctcctgcgagccgcaattgattattgcc
gacgaaccgactacggcgctggacgtcacgctacagttgcagctactgcgtttgcttaaa
cataaagcccgcgccagtggaactgcggtactgttcatcagccatgatatggtcgtggtg
tcgcaactgtgcgatagcgtttacgtgatgtatgccggaagcgtaattgaaagcggcgtg
acggcagacattatccatcatccccggcatccgtataccattggtttgctgcaatgcgca
ccagaacatggagtaccacgccagccattacccgccattccagggacggtaccaaacctc
acccatttgcctgaaggctgcgcttttcgcgatcgttgctatgcggcaggtgcacagtgt
gaaaacgtcccggcgctgacagcgtgtggtgacaacaaccagcgctgcgcctgttggtat
ccgcagcaggaggtcataagtgtctga

DBGET integrated database retrieval system