KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_2232Help
Entry
ECO103_2232       CDS       T01096                                 

Definition
(GenBank) putative copper/zinc-superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Brite
Enzymes [BR:eoh01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECO103_2232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: BAI31021
UniProt: C8U3Q8
LinkDB All DBs
Position
2292679..2293206
Genome map
AA seq 175 aa AA seqDB search
MKCKIIAAIAMLTAASCGYAAEQEVPMNLVSADGKEVSIGKITIQETPYGLLFTPALHSL
SEGIHGFHVHEKGNCAPALKDGKPVAALSAGGHFDPKNTGKHLGPWSPDGHLGDLPALFV
THDGKANYPVLAPRLNSLKEIKGRSLMLHAGGDNHHDHPEPLGGGGARMACGIIQ
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaatgtaaaatcattgctgccattgccatgctgacagcagcatcatgcggatacgca
gcagaacaggaagtcccaatgaaccttgtcagtgctgacggaaaagaagtcagcattgga
aaaataaccattcaggagaccccctacggtctgctgttcacaccagcccttcactctctg
tctgaaggcattcatggttttcatgtgcacgaaaaaggaaattgcgccccggcactgaaa
gacggaaaaccggtcgcagcattatcggctggcggtcactttgacccgaaaaacaccggc
aaacatcttggcccctggtctccggatggacacctgggcgacctccctgcgctgttcgtg
acgcatgacggaaaagcgaactacccggtcctggccccgagactgaactcattaaaagag
attaaagggcgttctctcatgcttcatgctggcggtgataaccatcatgaccatccggag
cccctgggcggtggtggtgcgagaatggcctgcggcatcattcaataa

DBGET integrated database retrieval system