KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_2825Help
Entry
ECO103_2825       CDS       T01096                                 

Definition
(GenBank) predicted tail fiber protein
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen Phage_fiber_C Phage_fiber_2 CarboxypepD_reg phage_tail_N
Motif
Other DBs
NCBI-ProteinID: BAI31592
LinkDB All DBs
Position
complement(2879358..2881295)
Genome map
AA seq 645 aa AA seqDB search
MSVVVSGTLKSPDGEAISGANITLTALTVSPDALSGTSASAVTREGGYYGMTMDPGEYAV
SVTVKGKTAVYGRVRIEGTESTVTLNMLLRRSLVEVSIPGELLTDFRQIQNNVADDLATI
RRLNEDTATKNAQATQSKESAAASAKSASDSAKTATSRAAEAGQKATDATEAATRAVTAA
GNAEESSTRAGESEKAAGADAEKARQHAEKARLAQESAGEILKRAEAATVSAEEARRMAE
NARGPRGPQGETGPKGDVGPKGETGPVGPQGPAGPKGERGDVGAQGAVGPAGPRGEKGEQ
GERGPQGIPGLKGDTGERGPKGDQGDMGPKGEKGDPGGPAGPQGPKGERGEAGPQGPMGA
RGERGETGPRGEPGPAGPRGERGETGPQGPRGEPGPAGSAANVADATTAQKGIVQLSSAT
DSDDETKAATPKAVKAAMDVANEAKTKAEEAAAGGGVPGPKGDKGDTGPAGPAGPKGDKG
ERGDTGPVGATGERGPAGDAGPAGPQGPKGDRGERGETGLTGNAGPQGPKGDTGAAGPAG
PQGPKGETGAAGPVGATGPQGPKGDPGETQIRFRMGPGNIIETNSNGWFPDTDGALITGL
TFLDPKDATRVQGFFQHLQVRFGDGPWQDVKGLDEVGSDTGRTGE
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgttgttgtttcggggacgctgaaatctcctgatggtgaggcgatatcaggagca
aatattaccctgacggcgctgacagtttcaccggatgcgctcagcggcaccagtgcgtcg
gcagtgacccgtgaaggtggatattacggaatgacgatggatccgggggagtatgcggtt
tcggtgacggtgaaagggaagactgctgtctacggacgtgtgcgtattgaggggaccgaa
agtacggtgacgctcaatatgctgttacgccgcagtcttgttgaggttagcatacccgga
gaactgctgacagatttccggcagatacagaataatgtggctgatgaccttgccactatt
cgtcgcctgaatgaagacacggcgacaaaaaacgctcaggccacacagtcaaaagaaagt
gcagcagccagtgcgaagagcgcatctgacagtgcaaagacggcaaccagcagggcggct
gaagccggacaaaaagcgactgatgccactgaggctgcgacccgtgcagtcacagcagcg
gggaatgcagaggaaagctcgacccgtgccggagagtctgaaaaagccgccggagctgat
gcagaaaaagccagacagcatgctgaaaaggccaggctggcgcaggagagcgccggagag
atccttaagcgggcagaggctgccactgtcagtgctgaagaggccagacgtatggctgag
aatgcacgggggccccgggggcctcagggagaaactggtccgaagggggatgtcggtcct
aaaggcgaaacaggtccagtgggccctcaagggcccgcagggccgaaaggtgagcgtggt
gacgttggtgctcagggggctgtagggcccgctggtccgcgtggtgagaagggcgaacag
ggggagcgaggaccgcagggaataccaggcctgaagggggataccggagagcgggggcct
aaaggggaccagggggatatggggccaaaaggcgagaaaggtgatccgggaggtcctgca
ggcccgcaaggtcctaaaggcgaacgaggagaagccggaccacagggaccgatgggagca
cgaggtgagcgtggggagactggcccccgaggtgaacctggtcctgcaggtccgagaggc
gaacgaggagagaccggacctcagggacctcgtggagagccaggtccggcaggcagcgct
gcaaatgtggctgatgcaacgacggcacagaagggaattgtgcagttaagcagcgcaacg
gacagtgatgatgaaacgaaggctgccaccccgaaagcggtgaaagcggcaatggatgtg
gcaaatgaagcgaaaacaaaggcagaagaggctgcagcaggaggtggtgttcccggtccg
aaaggagataaaggggacacggggccagcaggtccggctgggccgaagggtgataaggga
gagcgcggtgacaccggccctgtcggggcaaccggcgaacggggaccggcaggtgatgct
ggtccggcaggcccgcaggggccgaaaggtgacaggggagagcggggagagaccggtctg
acgggaaatgcaggtccacagggtccaaagggagataccggtgcggcaggcccggcaggc
ccacagggaccgaaaggagaaacaggtgcggctggcccggtaggggcaaccggacctcag
gggccgaagggcgacccgggggagacgcaaatacggttccgtatggggccgggaaacatt
attgagacaaacagcaatggctggttcccggatacagatggcgcactcatcaccggactg
acctttcttgaccccaaagatgccacacgggttcagggtttttttcagcatttgcaggtc
aggtttggtgacgggccgtggcaggatgtcaaggggctggatgaagtgggcagtgataca
ggcagaacaggagaatga

DBGET integrated database retrieval system