KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_2948Help
Entry
ECO103_2948       CDS       T01096                                 

Gene name
yfeW
Definition
(GenBank) predicted periplasmic esterase
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECO103_2948 (yfeW)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:eoh01002]
    ECO103_2948 (yfeW)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eoh01011]
    ECO103_2948 (yfeW)
Enzymes [BR:eoh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ECO103_2948 (yfeW)
Peptidases and inhibitors [BR:eoh01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   ECO103_2948 (yfeW)
Peptidoglycan biosynthesis and degradation proteins [BR:eoh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ECO103_2948 (yfeW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase
Motif
Other DBs
NCBI-ProteinID: BAI31714
UniProt: C8U7V9
LinkDB All DBs
Position
2997655..2998956
Genome map
AA seq 433 aa AA seqDB search
MKRTMLYLSLLAVSCSVSAAKYPVLTESSPEKAGFNVERLNQMDRWISQQVDAGYPGVNL
LIIKDNQIVYRKAWGAAKKYDGSVLMEQPVKATTGTLYDLASNTKMYATNFALQKLMSEG
KLHPDDRIAKYIPGFADSPNDTIKGKNTLRISDLLHHSGGFPADPQYPNKAVAGALYSQD
KGQTLEMIKRTPLEYQPGSKHIYSDVDYMLLGFIVESVTGQPLDRYVEESIYRPLGLTHT
VFNPLLKGFKPQQIAATELNGNTRDGVIHFPNIRTSTLWGQVHDEKAFYSMGGVSGHAGL
FSNTGDIAVLMQTMLNGGGYGDVQLFSAETVKMFTTSSKEDATFGLGWRVNGNATMTPTF
GTLASPQTYGHTGWTGTVTVIDPVNHMAIVMLSNKPHSPVADPQKNPNMFESGQLPIATY
GWVVDQVYAALKQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggacaatgctctatctttctctgctggctgttagttgtagcgtcagcgccgca
aaataccctgttctgacagaaagttcgccagagaaagcagggttcaacgtcgaacggctt
aaccagatggatcgctggattagccagcaagtggacgccggttatcccggcgtaaacctg
ctgatcattaaagataatcagattgtgtatcgcaaagcctggggagcggcgaaaaagtac
gatggcagcgtgttgatggaacagcctgtcaaagccaccaccgggacgctgtatgacctg
gcctcaaacaccaaaatgtacgccacgaacttcgccctgcaaaagctgatgagcgaaggc
aaactgcatcctgacgatcggattgcgaaatatattccggggtttgccgatagtccaaat
gacaccattaaaggcaaaaacaccctgcggatttctgacctgctgcatcacagcggcggt
ttcccggcagatccgcaatacccgaataaagcggtcgcgggcgcgttatattcccaggat
aaaggccagacgctggagatgatcaagcgcacgccgctagagtatcagcccggcagcaag
catatttacagtgatgtcgattatatgctgcttggatttatcgtcgagtcggtcaccggt
cagccgcttgaccgctatgttgaagagtcgatttatcgcccgctcggcctgacacatacg
gtatttaacccgctgctgaaaggctttaaaccgcaacaaattgccgccacggaattgaac
ggcaatacccgcgatggcgtgatccatttcccgaatatccgcacctccactctctggggt
caggtgcacgatgaaaaagccttttattcgatgggcggcgtttccgggcacgcaggtttg
ttttccaataccggcgatattgcggtgttaatgcaaacgatgctgaacggcgggggctat
ggcgatgtgcagctgttcagtgcggaaacggtgaagatgttcaccaccagctctaaggaa
gatgccacttttggcctcggctggcgcgtaaatggtaatgccaccatgacgccgacgttt
ggcacgctggcaagcccgcaaacctacggtcacactggctggaccggaacggtgaccgtt
atcgatccggtgaatcatatggcgattgtgatgttaagtaacaagccacattcaccggtt
gccgatccgcaaaagaatcccaatatgttcgaaagcggtcagttgccaattgcaacttat
ggttgggtggttgatcaggtatatgcggcgttaaagcagtaa

DBGET integrated database retrieval system