KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_3203Help
Entry
ECO103_3203       CDS       T01096                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate aminotransferase, PLP-dependent
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh00250  Alanine, aspartate and glutamate metabolism
eoh00280  Valine, leucine and isoleucine degradation
eoh00310  Lysine degradation
eoh00410  beta-Alanine metabolism
eoh00640  Propanoate metabolism
eoh00650  Butanoate metabolism
eoh01100  Metabolic pathways
eoh01120  Microbial metabolism in diverse environments
Module
eoh_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ECO103_3203 (gabT)
   00650 Butanoate metabolism
    ECO103_3203 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECO103_3203 (gabT)
   00280 Valine, leucine and isoleucine degradation
    ECO103_3203 (gabT)
   00310 Lysine degradation
    ECO103_3203 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECO103_3203 (gabT)
Enzymes [BR:eoh01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     ECO103_3203 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     ECO103_3203 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     ECO103_3203 (gabT)
Amino acid related enzymes [BR:eoh01007]
 Aminotransferase (transaminase)
  Class III
   ECO103_3203 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAI31954
UniProt: C8U995
LinkDB All DBs
Structure
PDB: 

Position
3255260..3256540
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEIMNQKVPGNFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYASSPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EDGDHNKPDAKLTAEIVARARDKGLILLSCGPYYNVLRILVPLTIEDAQIRQGLEIISQC
FDEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcgattccccgtggtgttggg
caaattcacccgattttcgctgaccgcgcggaaaactgccgggtgtgggacgttgaaggc
cgtgagtatcttgatttcgcgggcgggattgcggtgctcaataccgggcacttgcatccg
aaagtggtggctgcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcctacgagccgtatctggagctgtgcgagattatgaatcagaaggtgccaggcaat
tttgccaagaaaacgctgctggtcaccacaggttctgaagcggtggaaaacgcggtgaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacgcattacacgctggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccgggtcatgtttatcgcgcgctttatccttgcccgctgcacggcataagcgag
gatgacgctatcgccagcatccaccggatcttcaaaaatgatgccgcgccggaagatatc
gccgccatcgtgattgagccggttcagggcgaaggcggtttctacgcctcgtcgccagcc
tttatgcagcgtttacgcgctctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggcgcggggcgtaccggcacgctgtttgcgatggagcagatgggcgttgcg
ccggatcttaccacctttgcgaaatcgatcgcgggcggcttcccgctggcgggcgtcacc
gggcgcgcggaagtaatggatgccgtcgctccaggcggtctgggcggcacctatgcgggt
aacccgattgcctgcgtggctgcgctggaagtgttgaaggtgtttgagcaggaaaatctg
ctgcaaaaagccaacgatctggggcagaagttgaaagacggattgctggcaatagccgaa
aaacacccggagatcggcgacgtacgcgggctgggggcgatgatcgccattgagctgttt
gaagacggcgatcacaacaagccggacgccaaactcaccgccgagatcgtggctcgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgcgcatcctt
gtaccgctcaccattgaagacgctcagatccgtcagggtctggagatcatcagccagtgt
tttgatgaggcgaagcagtag

DBGET integrated database retrieval system