KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_5198
Entry
ECO103_5198       CDS       T01096                                 

Definition
(GenBank) Shiga toxin 1 subunit B
  KO
K11007  shiga toxin subunit B
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Pathway
eoh02024  Quorum sensing
eoh05130  Pathogenic Escherichia coli infection
Module
eoh_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECO103_5198
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECO103_5198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:eoh02042]
    ECO103_5198
Bacterial toxins [BR:eoh02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    ECO103_5198
SSDB
Motif
Pfam: SLT_beta PCC_BT
Other DBs
NCBI-ProteinID: BAI33873
LinkDB
Structure
PDB: 
1C4Q 1D1I 2XSC 1CQF 1QNU

Position
5388661..5388930
AA seq 89 aa
MKKTLLIAASLSFFSASALATPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLL
LSAQITGMTVTIKTNACHNGGGFSEVIFR
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaaaaaaacattattaatagctgcatcgctttcatttttttcagcaagtgcgctggcg
acgcctgattgtgtaactggaaaggtggagtatacaaaatataatgatgacgataccttt
acagttaaagtgggtgataaagaattatttaccaacagatggaatcttcagtctcttctt
ctcagtgcgcaaattacggggatgactgtaaccattaaaactaatgcctgtcataatgga
gggggattcagcgaagttatttttcgttga

DBGET integrated database retrieval system