KEGG   Escherichia coli O103 H2 12009 (EHEC): ECO103_p31Help
Entry
ECO103_p31        CDS       T01096                                 

Gene name
hylA
Definition
(GenBank) hemolysin A
  KO
K11005  hemolysin A
Organism
eoh  Escherichia coli O103:H2 12009 (EHEC)
Brite
KEGG Orthology (KO) [BR:eoh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eoh02000]
    ECO103_p31 (hylA)
   02042 Bacterial toxins [BR:eoh02042]
    ECO103_p31 (hylA)
Transporters [BR:eoh02000]
 Other transporters
  Pores ion channels [TC:1]
   ECO103_p31 (hylA)
Bacterial toxins [BR:eoh02042]
 Type II toxins: Membrane damaging toxins
  Pore-forming toxins, RTX
   ECO103_p31 (hylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RTX HemolysinCabind RTX_C
Motif
Other DBs
NCBI-ProteinID: BAI33964
LinkDB All DBs
Position
pO103:complement(29096..32092)
Genome map
AA seq 998 aa AA seqDB search
MTVNKIKNIFNNATLTTKSAFNTASSSVRSAGKKLILLIPDNYEAQGVGINELVKAADEL
GIEIHRTERDDTAIANQFFGAAEKVVGLTERGVAIFAPQLDKLLQKYQKVGSKIGGTAEN
VGNNLGKAGTVLSALQNFTGIALSGMALDELLRKQREGEDISQNDIAKSSIELINQLVDT
VSSINSTVDSFSEQLNQLGSFLSSKPRLSSVGGKLQNLPDLGSLGDGLDVVSGILSAVSA
SFILGNSDAHTGTKAAAGIELTTQVLGNVGKAVSQYILAQRMAQGLSTTAASAGLITSAV
MLAISPLSFLAAADKFERAKQLESYSERFKKLNYEGDALLAAFHKETGAIDAALTTINTV
LSSVSAGVSAASSASLIGAPISMLVSALTGTISGILEASKQAMFEHVAEKFAARINEWEK
EHGKNYFENGYDARHAAFLEDSLSLLADFSRQHAVERAVAITQQHWDEKIGELAGITRNA
DRSQSGKAYINYLENGGLLEAQPKEFTQQVFDPQKGTIDLSTGNVSSVLTFITPTFTPGE
EVRERKQSGKYEYMTSLIVNGKDTWSVKGIKNHKGVYDYSKLIQFVEKNNKHYQARIISE
LGDKDDVVYSGAGSSEVFAGEGHDTVSYNKTDVGKLTIDATGASKPGEYIVSKNMYGDVK
VLQEVVKEQEVSVGKRTEKIQYRDFEFRTGGIPYDVIDNLHSVEELIGGKHDDEFKGGKF
NDIFHGADGNDYIEGNYGNDRLYGDDGDDYISGGQGDDQLFGGSGNDKLSGGDGNNYLTG
GSGNDELQAHGAYNILSGGTGDDKLYGGGGIDLLDGGEGNDYLNGGFGNDIYVYRQNYGH
HTIADEGGKGDRLHLSDISFDDIAFKRVGNDLIMNKAINGVLSFNESNDVNGITFKNWFA
KDASGADNHLVEVITDKDGREIKVDKIPHNNNERSGYIKASNIASEKNMVNITSVANDIN
KIISSVSGFDSGDERLASLYNLSLHQNNTHSTTLTTTV
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaaataaaataaagaacattttcaataatgcgacattgactacaaaatcagca
tttaatacagcatcatcaagcgtacgttccgctggcaaaaaactcatattattaatacct
gataattatgaagctcagggcgtgggtattaatgagttggtcaaagctgctgatgagctt
ggaatagaaatacaccgtactgaacgagatgatacagcgattgcaaaccagttttttggt
gcagcagaaaaagttgtaggattaactgaacgtggtgttgcaatattcgcaccacaactt
gacaaacttctgcagaagtatcagaaagttgggagtaaaataggaggaaccgctgaaaat
gtaggtaataatctgggaaaagccggaacagttctctcagcactacagaattttacgggg
attgctttatcaggcatggctcttgatgaattgctgagaaaacaacgggaaggagaggat
ataagtcagaatgatattgccaaaagtagtattgaacttattaatcagcttgtagataca
gtatcaagtataaacagtaccgttgattcattttctgagcagcttaaccagcttggctca
tttttatccagtaaacctcgcttaagttctgttggtgggaaattacaaaatttaccagac
ctgggctccctgggggatgggctggatgttgtctccggaattctttctgctgtatcagca
agctttattctgggaaacagtgacgcacatacaggaacaaaagctgcagcgggtatagaa
ctgacaactcaggttcttggaaatgttggtaaagctgtttcgcaatatattctggctcag
agaatggcacaggggttatcgacaacagctgcaagtgcgggtctgatcacatcggctgtt
atgctggctatcagtcctctttctttcctggctgctgcagataaatttgagcgagctaag
cagcttgaatcatattctgaacgatttaaaaaattgaattatgaaggggatgctttactc
gcagcctttcataaagaaaccggagctatagatgcagccctgacaacaataaatactgtc
ctgagttctgtatctgcgggagttagtgcagcctccagtgcatccctcataggggccccg
ataagcatgctggtgagtgcattaaccggtacgatatctggcattctggaagcatcaaaa
caggctatgtttgagcacgttgcagagaaattcgctgctcggatcaatgaatgggaaaag
gagcatggcaaaaattattttgagaatggctatgacgcaagacatgctgcgtttttagaa
gactctctgtctttgcttgctgatttttctcgtcagcatgcagtagaaagagcagtcgca
ataacccagcaacattgggatgagaagatcggtgaacttgcaggcataacccgtaatgct
gatcgcagtcagagtggtaaggcatatattaattatctggaaaatggagggcttttagag
gctcaaccgaaggagtttacacaacaagtgtttgatcctcaaaaagggaccatagacctt
tcaacaggtaatgtatcaagtgttttgacatttataacaccaacatttaccccaggagaa
gaagttagagaaagaaaacagagtggtaaatatgaatatatgacatctcttattgtaaat
ggtaaggatacatggtctgtaaaaggcataaaaaatcataaaggtgtatatgattattca
aaattgattcagtttgttgaaaagaataacaaacactatcaggcgagaataatttctgag
ctcggagataaagacgatgtggtttattctggagcaggctcatcagaagtatttgctggt
gaaggtcatgataccgtatcttataataagacggatgttggtaaactaacaattgatgca
acaggagcatcaaaacctggtgagtatatagtttcaaaaaatatgtatggtgacgtgaag
gtattgcaggaagtcgttaaggaacaggaggtgtcagtagggaagcgaacagagaaaata
caatatcgtgattttgaattcagaaccggtggaattccttatgatgtaatagataatctt
cattctgttgaagagctcattggcggaaaacatgatgatgaattcaaaggcggtaagttt
aatgatatattccatggcgcagatgggaacgattatatcgaaggtaattatggtaatgat
cgactatacggcgatgatggggatgattatatatccggaggacagggagacgaccagtta
tttggtggtagtggaaacgataaattgagtggaggggatggtaataattatctgacagga
ggaagcggtaatgatgagcttcaggcacacggagcttataatattctgtcaggtggtact
ggtgatgataaactttatggtggtggtggtattgatcttctggatggaggggaaggtaat
gactatctgaatggtggttttggtaatgatatttatgtttataggcaaaactatggtcat
catacaattgcagatgaaggaggtaaaggagatcgtttgcacttatctgatattagcttt
gatgatatcgcatttaagagagttggaaatgatcttatcatgaataaagccattaatggt
gtactttcatttaatgagtcaaatgatgtcaatgggataacatttaaaaactggtttgcg
aaagatgcctcaggagcagataatcatcttgttgaggttataacagataaagatggtcga
gagataaaagttgataaaatacctcataataataatgaacggtcaggttatataaaagcc
agtaatatagcatctgaaaaaaacatggttaatatcaccagtgttgccaatgatattaat
aagattatttcttcagtttcaggattcgattcaggtgatgaacgattagcatctttatat
aatttatccttacatcaaaacaacacacactcaacaactttaacgacaactgtctga

DBGET integrated database retrieval system