KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_0740Help
Entry
ECO111_0740       CDS       T01097                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00020  Citrate cycle (TCA cycle)
eoi00190  Oxidative phosphorylation
eoi00650  Butanoate metabolism
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01120  Microbial metabolism in diverse environments
eoi01130  Biosynthesis of antibiotics
eoi01200  Carbon metabolism
Module
eoi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eoi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eoi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ECO111_0740 (sdhA)
   00650 Butanoate metabolism
    ECO111_0740 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ECO111_0740 (sdhA)
Enzymes [BR:eoi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ECO111_0740 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ECO111_0740 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: BAI34705
UniProt: C8UK22
LinkDB All DBs
Structure
PDB: 

Position
799356..801122
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDASESDVEVSLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagaatttgatgcagttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggccagacctgtgcgctgctctctaaagtcttc
ccgacccgttcccataccgtttctgcgcaaggcggcattaccgttgcgctgggtaatacc
catgaagataactgggaatggcatatgtacgacaccgtaaaagggtcggactatatcggt
gaccaggacgcgattgaatatatgtgtaaaaccgggccggaagcgattctggaactcgaa
cacatgggcctgccgttctcgcgtcttgatgatggtcgtatctatcaacgtccgtttggc
ggtcagtcgaaaaacttcggcggcgagcaggcggcacgcactgcggcggcggctgaccgt
accggtcacgcactgttgcacacgctttatcagcagaacctgaaaaaccacaccaccatt
ttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtgggttgt
accgcactgtgcatcgaaaccggtgaagtggtttatttcaaagcccgcgctaccgtgctg
gcgactggcggggcagggcgtatttatcagtccaccactaacgcccacattaacactggc
gacggtgtcggcatggctatccgcgcaggcgtaccggtgcaggatatggaaatgtggcaa
ttccacccgaccggcattgccggtgcgggcgtactggtcaccgaaggttgccgtggtgaa
ggcggttatctgctgaacaaacatggcgaacgctttatggagcgttatgcgccgaacgcc
aaagacctggcgggccgtgatgtggtggcgcgttccatcatgattgaaatccgtgaaggt
cgcggctgtgatggtccgtgggggccacacgcgaaactgaaactcgatcacctgggtaaa
gaagttctcgaatcccgtctgccgggtatcctggagctttcccgtaccttcgctcacgtc
gatccggtgaaagagccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagttaccggtcaggcgctgactgtgaatgagaaaggcgaagatgtggttgtt
ccgggactgtttgccgttggtgaaatcgcttgtgtatcggtacacggcgctaaccgtctg
ggcggcaactcgctgctggacctggtggtctttggtcgcgcggcaggtctgcatctgcaa
gagtctatcgccgagcagggcgcactgcgcgatgccagcgagtctgatgttgaagtgtct
ctggatcgcctgaaccgctggaacaataatcgtaacggtgaagatccggtggcgattcgt
aaagcgctgcaagaatgtatgcagcataacttctcggtcttccgtgaaggtgatgcgatg
gcgaaagggcttgagcagttgaaagtgatccgcgagcgtctgaaaaatgcccgtctggat
gacacttccagcgagttcaacacccagcgcgttgagtgcctggaactggataacctgatg
gaaacggcgtatgcaacggctgtttctgccaacttccgtaccgaaagccgtggcgcacat
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccactccctgtatctg
ccagagtcggaatccatgacgcgccgaagcgtcaacatggaaccgaaactgcgcccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system