KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_2429
Entry
ECO111_2429       CDS       T01097                                 

Definition
(GenBank) Shiga toxin 2 subunit B
  KO
K11007  shiga toxin subunit B
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi02024  Quorum sensing
eoi05130  Pathogenic Escherichia coli infection
Module
eoi_M00363  EHEC pathogenicity signature, Shiga toxin
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECO111_2429
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECO111_2429
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:eoi02042]
    ECO111_2429
Bacterial toxins [BR:eoi02042]
 Type III toxins: Intracellular toxins
  Others
   Shiga toxin
    ECO111_2429
SSDB
Motif
Pfam: SLT_beta Peptidase_C28 DUF2541 PCC_BT
Other DBs
NCBI-ProteinID: BAI36293
UniProt: C8UC21
LinkDB
Structure
PDB: 
4M1U 1R4P 3MXG

Position
complement(2424080..2424349)
AA seq 89 aa
MKKMFMAVLFALVSVNAMAADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQS
AQLTGMTVTIKSSTCESGSGFAEVQFNND
NT seq 270 nt   +upstreamnt  +downstreamnt
atgaagaagatgtttatggcggttttatttgcattagtttctgttaatgcaatggcggcg
gattgtgctaaaggtaaaattgagttttccaagtataatgaggatgacacatttacagtg
aaggttgacgggaaagaatactggaccagtcgctggaatctgcaaccgttactgcaaagt
gctcagttgacaggaatgactgtcacaatcaaatccagtacctgtgaatcaggctccgga
tttgctgaagtgcagtttaataatgactga

DBGET integrated database retrieval system