KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_3891Help
Entry
ECO111_3891       CDS       T01097                                 

Gene name
ygjF
Definition
(GenBank) G/U mismatch-specific DNA glycosylase
  KO
K03649  double-stranded uracil-DNA glycosylase [EC:3.2.2.28]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    ECO111_3891 (ygjF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eoi03400]
    ECO111_3891 (ygjF)
Enzymes [BR:eoi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.28  double-stranded uracil-DNA glycosylase
     ECO111_3891 (ygjF)
DNA repair and recombination proteins [BR:eoi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     ECO111_3891 (ygjF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: BAI37671
UniProt: C8UG27
LinkDB All DBs
Structure
PDB: 

Position
complement(3875570..3876076)
Genome map
AA seq 168 aa AA seqDB search
MVEDILAPGLRVVFCGINPGLSSAGTGFPFAHPANRFWKVIYQAGFTDRQLKPQEAQHLL
DYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKQAYEQGFSQRG
AQWGKQTLTIGSTQIWVLPNPSGLSRVSLEKLVEAYRELDQALVVRGR
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggatattttggctccagggttacgggtcgtgttttgcggtatcaaccctggg
ctttcatccgccgggactggttttccctttgctcatccagcaaatcgcttctggaaggtg
atatatcaggccgggtttaccgaccgtcagttgaagccgcaggaggcacagcatctgctg
gattatcgttgtggcgtcaccaaactggtagaccgtccaacggtgcaagccaatgaagtt
tcaaagcaggagctgcacgcaggtgggcgtaagctgattgaaaaaattgaagattatcag
ccgcaggcgttggcgattctgggcaaacaagcatatgaacagggattcagccagcgcggt
gcacagtgggggaaacaaacgctcaccattggttcgacgcagatttgggtgctgccaaat
cccagcggtttaagtcgcgtttcactagagaaactggttgaagcatatcgcgagctggac
caggcgctggtagtgcgtgggcgataa

DBGET integrated database retrieval system