KEGG   Escherichia coli O111 H- 11128 (EHEC): ECO111_4199Help
Entry
ECO111_4199       CDS       T01097                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
eoi  Escherichia coli O111:H- 11128 (EHEC)
Pathway
eoi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eoi01100  Metabolic pathways
eoi01110  Biosynthesis of secondary metabolites
eoi01130  Biosynthesis of antibiotics
eoi01230  Biosynthesis of amino acids
Module
eoi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:eoi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECO111_4199 (aroK)
Enzymes [BR:eoi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ECO111_4199 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin2 Cytidylate_kin dNK AAA_16 AAA AAA_22 APS_kinase TsaE ABC_tran AAA_7 His_biosynth AAA_17 AAA_5 Ploopntkinase3 RNA_helicase AAA_25 AAA_PrkA AAA_28 AAA_29 RsgA_GTPase PduV-EutP Mg_chelatase AAA_24 IstB_IS21 AAA_14 GTP_EFTU MMR_HSR1
Motif
Other DBs
NCBI-ProteinID: BAI37967
UniProt: C8UHM1
LinkDB All DBs
Structure
PDB: 

Position
complement(4174266..4174787)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFYDSDQEIEKRTGADVGWVFDLEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLHVETPPREVLEALANERNPLYEEIADVTIRTDDQSAKVVANQIIHMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggaaaaagcactatt
gggcgccagttagctcaacaactcaatatggaattttacgattccgatcaagagattgag
aaacgaaccggagctgatgtgggctgggttttcgatttagaaggcgaagaaggcttccgc
gatcgcgaagaaaaggtcatcaatgagttgaccgagaaacagggtattgtgctggctact
ggcggcggctctgtgaaatcccgtgaaacgcgtaaccgtctttccgctcgtggcgttgtc
gtttatcttgaaacgaccatcgaaaagcaacttgcacgcacgcagcgtgataaaaaacgc
ccgttgctgcacgttgaaacaccgccgcgtgaagttctggaagcgttggccaatgaacgc
aatccgctgtatgaagagattgccgacgtgaccattcgtactgatgatcaaagcgctaaa
gtggttgcaaaccagattattcacatgctggaaagcaactaa

DBGET integrated database retrieval system