KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_0123Help
Entry
ECO26_0123        CDS       T01098                                 

Gene name
speE
Definition
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
eoj00270  Cysteine and methionine metabolism
eoj00330  Arginine and proline metabolism
eoj00410  beta-Alanine metabolism
eoj00480  Glutathione metabolism
eoj01100  Metabolic pathways
Module
eoj_M00133  Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    ECO26_0123 (speE)
   00330 Arginine and proline metabolism
    ECO26_0123 (speE)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECO26_0123 (speE)
   00480 Glutathione metabolism
    ECO26_0123 (speE)
Enzymes [BR:eoj01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     ECO26_0123 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_25 Methyltransf_11 MTS Methyltransf_31 Methyltransf_12 MetW
Motif
Other DBs
NCBI-ProteinID: BAI23484
LinkDB All DBs
Structure
PDB: 

Position
complement(138435..139301)
Genome map
AA seq 288 aa AA seqDB search
MAEKKQWHETLHDQFGQYFAVDNVLYHEKTDHQDLIIFENAAFGRVMALDGVVQTTERDE
FIYHEMMTHVPLLAHGHAKHVLIIGGGDGAMLREVTRHKNVESITMVEIDAGVVSFCRQY
LPNHNAGSYDDPRFKLVIDDGVNFVNQTSQTFDVIISDCTDPIGPGESLFTSAFYEGCKR
CLNPGGIFVAQNGVCFLQQEEAIDSHRKLSHYFSDVGFYQAAIPTYYGGIMTFAWATDND
ALRHLSTEIIQARFLASGLKCRYYNPAIHTAAFALPQYLQDALASQPS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaaaaacagtggcatgaaacgctacacgaccagtttgggcagtactttgcg
gtagataacgttctgtatcatgaaaagaccgatcaccaggatctgatcatttttgagaac
gctgcatttggtcgcgtaatggcgctggatggcgtagtacaaaccaccgagcgcgacgag
tttatctatcatgagatgatgacccatgttccgctactggcccacggtcacgcgaaacat
gtgctgattatcggcggcggcgacggtgccatgctgcgtgaagtaacccgacataaaaac
gttgagtcaatcacgatggtggaaatcgatgcgggtgtcgtgtcgttctgccgtcagtat
ctgcccaaccataacgccggtagctacgacgatccgcgctttaagctggtgatcgacgat
ggcgtcaatttcgttaatcaaaccagccagacctttgatgtcattatctccgactgcacc
gatcctatcggtcccggcgaaagtctgttcacctcagcattttatgaaggctgcaaacgt
tgcctgaatcctggcggtatcttcgtcgcacaaaacggcgtctgctttttacagcaggaa
gaagccatcgacagccatcgcaaactcagccattacttcagcgacgttggcttttatcag
gcggcgatcccgacctattacggcggtatcatgacttttgcatgggcgacagataacgac
gccttacgccatctctcaaccgaaattattcaggcgcgttttctcgcttctggcctgaaa
tgccgttattacaatccggcaatccatacggcagcttttgccttacctcagtatctgcaa
gacgcactggcttcacagccgtcctaa

DBGET integrated database retrieval system