KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_0414Help
Entry
ECO26_0414        CDS       T01098                                 

Gene name
ddlA
Definition
(GenBank) D-alanine-D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
eoj00473  D-Alanine metabolism
eoj00550  Peptidoglycan biosynthesis
eoj01100  Metabolic pathways
eoj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ECO26_0414 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ECO26_0414 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    ECO26_0414 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eoj01011]
    ECO26_0414 (ddlA)
Enzymes [BR:eoj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ECO26_0414 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:eoj01011]
 Precursor biosynthesis
  Amino acid ligase
   ECO26_0414 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: BAI23754
LinkDB All DBs
Position
complement(445190..446284)
Genome map
AA seq 364 aa AA seqDB search
MEKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDASNYLLN
ADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHNISFAEVESKLGL
PLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDNPQ
ASTCGEIVLTSDFYAYDTKYIDEDGAKVVVPAAIAPEINDKIRAIAVQAYQTLGCAGMAR
VDVFLTPENEVVINEINTLPGFTNISMYPKLWQASGLGYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactgcgggtaggaatcgtttttggtggtaaatcagcggaacatgaagtgtct
ctgcaatcggcaaaaaacattgtcgatgccattgataaaagtcgcttcgacgttgtgctg
ctgggcattgataaacaagggcaatggcacgtcagcgatgccagcaattatctgctaaat
gcagacgatcctgcccatattgcgttacgcccttcggcgaccagccttgcgcaggtgcca
ggtaaacatgagcatcagcttatcgacgcgcaaaacggtcagccgttgccgacggtggat
gtcattttcccgattgtccacggtacgctgggcgaagatggttccttgcagggaatgctg
cgggtcgccaatttaccgttcgtaggttctgatgttctggcttcagcagcctgtatggat
aaagatgttaccaaacgtctgctgcgcgatgccgggctgaacattgcgccatttattacc
ctgacgcgcgccaatcgtcacaacattagttttgccgaagtggagtctaaactggggtta
ccactgtttgtaaaaccggctaatcagggctcttctgttggtgtcagcaaagtaaccagt
gaagaacagtacgcaattgccgtcgatctggcgttcgaattcgatcataaagtgatcgtt
gagcaagggatcaaaggtcgtgagatcgaatgcgcagttctgggcaacgacaacccgcaa
gccagcacctgtggcgagatcgtactcaccagcgacttctatgcctacgacaccaagtac
attgacgaagatggcgcgaaagtggtagttccggcagccattgcgccagaaatcaacgat
aagatccgggcgattgccgttcaggcttatcaaacgttgggatgcgcaggcatggcgcgt
gtagacgtgtttttaaccccagaaaacgaagtggtgatcaacgagatcaacacactgcct
ggcttcaccaacatcagtatgtatccgaagctgtggcaagccagcggtctgggttacacc
gatctgatcacacgtttgattgagctggcgctggagcgtcacgctgcggataacgcattg
aaaaccacaatgtaa

DBGET integrated database retrieval system