KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_4513Help
Entry
ECO26_4513        CDS       T01098                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase GlpD, aerobic, FAD/NAD(P)-binding
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
eoj00564  Glycerophospholipid metabolism
eoj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ECO26_4513 (glpD)
Enzymes [BR:eoj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ECO26_4513 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored NAD_binding_8 Pyr_redox_2 3HCDH_N FAD_binding_2 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: BAI27683
LinkDB All DBs
Structure
PDB: 

Position
4480082..4481587
Genome map
AA seq 501 aa AA seqDB search
METKDLIVIGGGINGAGIAADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYE
FRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGS
TGLRFGANSVLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENG
LWIVEAEDIDTGKKYSWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVH
TQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHF
KKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRK
LAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYART
YGSNSELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRTDDALWRRTKQGMWLNAD
QQSRVSQWLVEYTQQKLSLAS
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaaagatctgattgtgataggtggcggcatcaatggtgctggtatcgcggca
gacgccgctggacgcggtttatccgtgctgatgctggaggcgcaggatctcgcttgtgcg
acctcttccgccagttcaaaactcattcacggtggcctgcgctaccttgagcactatgaa
ttccgcctggtcagcgaggcgctggctgaacgtgaagtgctgctgaaaatggctccgcat
atcgccttcccgatgcgttttcgcctgccacatcgtccgcatctgcgcccggcgtggatg
attcggattggtctgtttatgtacgatcatctgggtaaacgcaccagcctgccgggatca
accggtttgcgttttggcgcaaactcagtgttaaaaccggaaattaagcgcggattcgaa
tattctgactgttgggtagacgacgcccgtctggtactcgccaacgcccagatggtggtg
cgtaaaggcggcgaagtgcttactcggactcgcgccacctctgctcgccgcgaaaacggc
ctgtggattgtggaagcggaagatatcgataccggcaaaaaatatagctggcaagcgcgc
ggcctggttaacgccaccggcccgtgggtgaaacagttcttcgacgaggggatgcatctg
ccttcgccttatggcattcgcctgatcaaaggcagccatattgtggtgccgcgtgtgcat
acccagaagcaggcctacattctgcaaaacgaagataaacgtattgtgttcgtgatcccg
tggatggacgaattttccatcatcggcaccaccgacgtagagtataaaggcgatccgaaa
gcggtgaagattgaagagagtgaaatcaactatctgctgaaagtgtataacgcgcacttt
aaaaaacagcttagccgtgacgatatcgtctggacctactccggtgtgcgtccgctgtgt
gatgatgagtccgactcgccgcaggctattacccgtgattacacccttgatatccatgat
gaaaacggcaaagcaccgctgctgtcggtattcggcggtaagctgaccacctaccgaaaa
ctggcagaacatgcgctggaaaaactgacgccgtattatcagggtattggcccggcgtgg
acgaaagagagcgtgctgccgggtggtgccattgaaggcgaccgcgacgattacgcagct
cgtctgcgccgtcgctatccattcctgactgaatcgctggcgcgtcattacgcacgcact
tacggcagcaacagcgagctgctgctcggcaatgcgggggcgataagcgacctcggggag
gatttcggtcatgagttctacgaagcggaactgaaatacctggtggatcacgaatgggtc
cgccgcaccgacgatgccctttggcgtcgcacaaaacaaggcatgtggctgaatgcggat
caacaatctcgtgtgagtcagtggctggtggaatatacgcagcagaagttgtcgctggcg
tcgtaa

DBGET integrated database retrieval system