KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_5289Help
Entry
ECO26_5289        CDS       T01098                                 

Gene name
espF
Definition
(GenBank) T3SS secreted effector EspF
  KO
K12786  LEE-encoded effector EspF
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
eoj05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    ECO26_5289 (espF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspF
Motif
Other DBs
NCBI-ProteinID: BAI28431
LinkDB All DBs
Position
5364045..5364668
Genome map
AA seq 207 aa AA seqDB search
MLNGISQAVSTLGRHITSAASRVSSAGLSGFSVSPQAVRLNPIRAQSPFSPGTSNINART
TFNVSSPATSFTPSRPAPPPPTSGQASGASRPLPPIAQALKDHLAAYEKSKSLDTSSLKP
SRPAPPPPTSGLVSGSSRSLPPIAQALKDHLAAYEKSKSLDTSGLKPSRPAPPPPTSGQA
SEASRPLPPIAQALKDHLAAYELSKKA
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatggaattagtcaagctgtttctacactaggacggcatattactagtgcggca
agccgggtaagctctgcggggttatctggcttttcagtgtcccctcaggctgttcgtctg
aatccgattagggctcaatctcctttttctcccggtacgtcgaatatcaatgcgagaacg
acttttaatgtgagtagcccggcgacttcatttactccctctcgtccggccccaccgccg
ccgacaagtggacaggcttccggggcatcccgccctttaccgcccattgctcaggcatta
aaagatcatttagctgcctatgaaaagtcgaaaagtcttgatacttcaagccttaagcca
agccgcccggcaccgccgccgccgacaagcgggttggtatctgggtcatcccggtcttta
ccgcccattgctcaggcgctaaaagatcatttggctgcctatgaaaaatcgaaaagtctt
gatacttcaggtcttaagccaagccgcccggcaccgccgccaccgacaagtggacaggca
tccgaggcatcccggccattaccgcctattgctcaggcattaaaagatcatttagctgcc
tatgaactgtcgaaaaaggcataa

DBGET integrated database retrieval system