KEGG   Escherichia coli O26 H11 11368 (EHEC): ECO26_5565Help
Entry
ECO26_5565        CDS       T01098                                 

Gene name
yjjN
Definition
(GenBank) predicted oxidoreductase, Zn-dependent and NAD(P)-binding
  KO
K23007  L-galactonate 5-dehydrogenase [EC:1.1.1.414]
Organism
eoj  Escherichia coli O26:H11 11368 (EHEC)
Pathway
eoj00053  Ascorbate and aldarate metabolism
eoj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eoj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    ECO26_5565 (yjjN)
Enzymes [BR:eoj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.414  L-galactonate 5-dehydrogenase
     ECO26_5565 (yjjN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C 3HCDH_N 2-Hacid_dh_C Pyr_redox_2 Sacchrp_dh_NADP AdoHcyase_NAD HI0933_like TrkA_N Pyr_redox_3 FAD_binding_3 Pyr_redox NAD_binding_7 NAD_binding_8 FAD_binding_2 GIDA Shikimate_DH UDPG_MGDP_dh_N XdhC_C Thi4 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: BAI28685
LinkDB All DBs
Position
5652519..5653541
Genome map
AA seq 340 aa AA seqDB search
MSTMKVLICQEIKNLVWTVRERPVPGDNEALIKIKTVGICGTDIHAWAGNQPFFSYPRVL
GHEICGEIIESGKNFHNFNIGQQVAVIPYISCQQCPACKSGRTNCCEKISVIGVHQDGGF
SEYLSVPVANILPADGIDPQAAALIEPFAISAHAVRRAAIAPGEQVLVVGAGPIGLGAAA
IAKADGAQVVVADTSPARREHVATRLELPVLDPSAEDFDAQLRAQFGGSLAQKVIDATGN
QHAMNNTVNLIRHGGTVVFVGLFKGELQFSDPEFHKKETTMMGSRNATPEDFAKVGRLMA
EGKITADMMLTHRYPFATLAETYERDVINNRELIKGVITF
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaatgaaagtattaatttgtcaggaaataaagaatttagtatggacagtccgg
gaaagaccggtgccaggcgataatgaagcattaattaaaattaaaaccgtcgggatttgc
ggtacagatattcatgcctgggcgggcaatcaaccattttttagctatccacgcgtttta
ggccatgaaatatgtggggagattattgaatcaggaaaaaactttcacaattttaatatc
ggacagcaagttgcggtaattccgtatatttcttgtcagcaatgcccggcgtgtaaaagc
gggcgtaccaattgctgtgaaaaaatttcagtcattggcgtgcatcaggatggcggtttt
agtgagtatttgagcgtgccggtggcgaacattttgcccgcagacggtattgacccgcag
gcggccgcattgattgaacctttcgctattagcgctcatgcggtgcgtcgcgcagccatt
gctcccggcgagcaggtgctggtggtcggggcggggccaatcggtctgggcgcggcggca
atcgctaaagccgatggcgcacaggtggtggtggcggataccagtccggcgcgccgtgaa
catgtggcaacgcgtctggagttgcccgtgctggacccgtcagccgaagattttgacgcg
cagttgcgggcgcagtttggtggttcgctggcgcagaaagtgatcgacgcgacaggtaat
caacatgcgatgaataacaccgtgaatctgattcgtcacggcggcacggtggtatttgtc
ggcctgtttaaaggtgagttgcagttctccgatccggaattccataaaaaagaaacgacg
atgatgggcagccgcaacgccacgccggaagattttgctaaagtcggtcgactgatggcg
gaaggaaaaatcactgctgacatgatgttaacccatcgctatccgttcgccacgctggca
gaaacctacgagcgcgatgtgattaacaatcgtgagttaattaaaggtgtaattactttc
tga

DBGET integrated database retrieval system