KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0096Help
Entry
G2583_0096        CDS       T01190                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase B
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00473  D-Alanine metabolism
eok00550  Peptidoglycan biosynthesis
eok01100  Metabolic pathways
eok01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eok00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    G2583_0096 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    G2583_0096 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    G2583_0096 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eok01011]
    G2583_0096 (ddlB)
Enzymes [BR:eok01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     G2583_0096 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:eok01011]
 Precursor biosynthesis
  Amino acid ligase
   G2583_0096 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_YheCD TTL ATPgrasp_ST GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: ADD54751
UniProt: D3QVH8
LinkDB All DBs
Structure
PDB: 

Position
106794..107714
Genome map
AA seq 306 aa AA seqDB search
MTDKIAVLLGGTSAEREVSLNSGAAVLAGLREGGIDAYPVDPKEVDVTQLKSMGFQKVFI
ALHGRGGEDGTLQGMLELMGLPYTGSGVMASALSMDKLRSKLLWQGAGLPVAPWVALTRV
EFEKGLSDKQLAEISALGLPVIVKPSREGSSVGMSKVVAENALQDALRLAFQHDEEVLIE
KWLSGPEFTVAILGEEILPSIRIQPSGTFYDYEAKYLSDETQYFCPAGLEASQEANLQAL
VLKAWTTLGCKGWGRIDVMLDSDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgactgataaaatcgcggtcctgttgggcgggacttccgctgagcgggaagtttctctg
aattctggcgcagcggtgttagccgggctgcgtgaaggcggtattgacgcatatcctgtc
gacccgaaagaagttgacgtgacgcaactgaagtcgatgggctttcagaaagtgtttatc
gcgctacacggccgcggcggtgaagatggtacgctgcaggggatgctcgagctgatgggc
ttgccttataccggcagcggagtgatggcatctgcgctttcaatggataaactacgcagc
aaacttctgtggcaaggtgccggtttaccggtcgcgccgtgggtagcgttaacccgcgta
gagtttgaaaaaggcctgagtgataagcagttagcagaaatttctgctctgggtttgccg
gttatcgttaagccgagccgcgaaggttccagtgtgggaatgtcaaaagtagtagcagaa
aatgctctacaagatgcattaagattggcatttcagcacgatgaagaagtattgattgaa
aaatggctaagtgggccggagttcacggttgcgatactcggtgaagaaattttaccgtca
atacgtattcaaccgtccggaaccttctatgattatgaggcgaagtatctctctgatgag
acacagtatttctgccccgcaggtctggaagcgtcacaagaggccaatttgcaggcatta
gtgctgaaagcatggacgacgttaggttgcaaaggatggggacgtattgacgttatgctg
gacagcgatggacagttttatctgctggaagccaatacctcaccgggtatgaccagccac
agcctggtgccgatggcggcacgtcaggcaggtatgagcttctcgcagttggtagtacga
attctggaactggcggactaa

DBGET integrated database retrieval system