KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_0491Help
Entry
G2583_0491        CDS       T01190                                 

Gene name
phoA
Definition
(GenBank) Alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00730  Thiamine metabolism
eok00790  Folate biosynthesis
eok01100  Metabolic pathways
eok02020  Two-component system
Module
eok_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:eok00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    G2583_0491 (phoA)
   00790 Folate biosynthesis
    G2583_0491 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    G2583_0491 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eok04147]
    G2583_0491 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eok00537]
    G2583_0491 (phoA)
Enzymes [BR:eok01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     G2583_0491 (phoA)
Exosome [BR:eok04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   G2583_0491 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eok00537]
 Enzymes
  G2583_0491 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest
Motif
Other DBs
NCBI-ProteinID: ADD55120
UniProt: D3QJF0
LinkDB All DBs
Structure
PDB: 

Position
501143..502627
Genome map
AA seq 494 aa AA seqDB search
MSRPRLIVALFLFFNVFVHGENKVKQSTIALALLPLLFTPVTKARTPEMPVLENRAAQGD
ITAPGGARRLTADQTAALRDSLSDKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGI
DALPLTGQYTHYALNKKTGKPDYVTDSAASATAWSTGVKTYNGALGVDIHEKDHPTILEM
AKAAGLATGNVSTAELQDATPAALVAHVTSRKCYGPSATSEKCPGNALEKGGKGSITEQL
LNARADVTLGGGAKTFAETATAGEWQGKTLREQAQARGYQLVSDAASLNSVTEANQQKPL
LGLFADGNMPVRWLGPKATYHGNIDKPAVTCTPNPQRNDSVPTLAQMTDKAIELLSKNEK
GFFLQVEGASIDKQDHAANPCGQIGETVDLDEAVQRALEFAKKDGNTLVIVTADHAHASQ
IVAPDTKAPGLTQALNTKDGAVMVMSYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQ
TDLFYTMKAALGLK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
ttgtcacggccgagacttatagtcgctttgtttttattttttaatgtatttgtacatgga
gaaaataaagtgaaacaaagcactattgcactggcactcttaccgttactgtttacccct
gtgacaaaagcccggacaccagaaatgcctgttctggaaaaccgggctgctcagggcgat
attactgcacccggcggtgctcgccgcttaacggctgatcagaccgccgctctgcgtgat
tctcttagcgataaacctgcaaaaaatattattttgctgattggcgatgggatgggggat
tcggaaattactgccgcacgtaattatgccgaaggtgcgggcggcttttttaaaggtatc
gatgccttaccgcttaccgggcaatacactcactatgcgctgaataaaaaaaccggaaaa
ccggactacgtcaccgactcggctgcatcagcaaccgcctggtcaaccggtgtcaaaacc
tataacggcgcgctgggcgtcgatattcacgaaaaagatcacccaacgattctggaaatg
gcaaaagccgcaggtctggcgaccggtaacgtttctaccgcagagttgcaggatgccacg
cccgccgcgctggtggcgcatgtgacctcgcgcaaatgctacggtccgagcgcgaccagt
gaaaaatgtccgggtaacgctctggaaaaaggcggaaaaggatcgattaccgaacagctg
cttaacgctcgtgccgacgttacgcttggcggcggcgcaaaaacctttgctgaaacggca
accgctggtgaatggcagggaaaaacgctgcgtgaacaggcacaggcgcgtggttatcag
ttggtgagcgatgctgcctcactgaattcggtgacggaagcgaatcagcaaaaacccctg
cttggcctgtttgctgacggcaatatgccagtgcgctggctaggaccgaaagcaacgtac
cacggtaatatcgataagcccgcagtcacctgtacgcctaatccgcaacgtaatgacagt
gtaccgaccctggcacagatgaccgacaaagccattgaattgttgagtaaaaatgagaaa
ggctttttcctgcaagttgaaggtgcgtcaatcgataaacaggatcatgctgcgaatcct
tgtgggcaaattggcgagacggtcgatctcgatgaagccgtacaacgggcgctggaattc
gccaaaaaggatggtaacacgctggtcatagtcaccgctgatcacgcccacgccagccag
attgttgcgccggataccaaagctccgggcctcacccaggcgctaaataccaaagatggc
gcagtgatggtgatgagttacgggaactccgaagaggattcacaagaacataccggcagt
cagttgcgtattgcggcgtatggcccgcatgccgccaatgtcgttggactgaccgaccag
accgatctcttctacaccatgaaagccgctctggggctgaaataa

DBGET integrated database retrieval system