KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2037Help
Entry
G2583_2037        CDS       T01190                                 

Gene name
slyA
Definition
(GenBank) Transcriptional regulator
  KO
K06075  MarR family transcriptional regulator, transcriptional regulator for hemolysin
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Brite
KEGG Orthology (KO) [BR:eok00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eok03000]
    G2583_2037 (slyA)
Transcription factors [BR:eok03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    G2583_2037 (slyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_Crp_2 HTH_20 B-block_TFIIIC HxlR HTH_5 HTH_24 TrmB HTH_36 LexA_DNA_bind Replic_Relax DUF4423 GntR RP-C GlnD_UR_UTase DUF2250 RsbU_N Fe_dep_repress
Motif
Other DBs
NCBI-ProteinID: ADD56608
UniProt: D3QTZ9
LinkDB All DBs
Position
complement(2077421..2077855)
Genome map
AA seq 144 aa AA seqDB search
MESPLGSDLARLVRIWRALIDHRLKPLELTQTHWVTLHNIHQLPPDQSQIQLAKAIGIEQ
PSLVRTLDQLEEKGLISRQTCASDRRAKRIKLTEKAEPLISEMEAVINKTRAEILHGISA
EELEQLITLIAKLEHNIIELQAKG
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
ttggaatcgccactaggttctgatctggcacggttggtgcgcatatggcgtgctctgata
gaccatcgcctgaaaccgctggagttaacacaaacccattgggttacgttacacaatatc
catcagttacctccagaccagtcgcaaattcaactggcaaaagcgattggcatcgagcag
ccatcactggtccgtactctggaccaactggaagaaaaagggttaatttcgcgtcaaact
tgtgccagcgatcgtcgggctaaacgtattaaactgacggaaaaggcagagccgctgatc
agcgaaatggaagctgttattaacaaaacccgcgcggaaattttacatggcatctccgca
gaggaactggaacaactgattacgctcatcgcaaaacttgagcataatatcattgagtta
caggccaaagggtga

DBGET integrated database retrieval system