KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2781Help
Entry
G2583_2781        CDS       T01190                                 

Gene name
glpA
Definition
(GenBank) Anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00564  Glycerophospholipid metabolism
eok01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eok00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    G2583_2781 (glpA)
Enzymes [BR:eok01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     G2583_2781 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Thi4 Pyr_redox_2 3HCDH_N HI0933_like NAD_binding_8 Pyr_redox_3 Lycopene_cycl GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ADD57320
UniProt: D3QKT8
LinkDB All DBs
Position
2824225..2825853
Genome map
AA seq 542 aa AA seqDB search
MKTRDSQSSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTNGLFITLPEDDLSFQATFIRACEEAGISAEA
IDPQQARIIEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAKEHGAVILTAHEVTGLIRE
GATVCGVRVRNHLTGETQALHAPVVVNAAGIWGQHIAEYADLRIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSLRIDYNEIDDNRVTAEEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTADLALPGSQEPAEVTLRKVISLPAPLRGSAVYRHGDRTP
AWLSEGRLHRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSIEQLSTFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQKD
AL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactcgcgactcgcaatcaagtgacgtgattatcattggcggcggcgcaacggga
gccggaattgcccgcgactgtgccctgcgcgggctgcgcgtgattttggttgagcgccac
gacatcgcaaccggtgccaccgggcgtaaccacggcctgctgcacagcggtgcgcgctat
gcggtaaccgatgcggaatcggcccgcgaatgcattagtgaaaaccagatcctgaaacgc
attgcacgtcactgcgttgaaccaaccaacggcctgtttatcaccctgccggaagatgac
ctctccttccaggccacttttattcgcgcctgcgaagaagcagggatcagcgcagaagct
atagacccgcagcaagcgcgcattatcgaacctgccgttaacccggcactgattggcgcg
gtgaaagttccggatggcaccgttgatccatttcgtctgaccgcagcaaacatgctggat
gccaaagaacacggtgctgttatccttaccgctcatgaagtcacggggctgattcgtgaa
ggcgcgacggtgtgcggtgttcgtgtacgtaaccatctcaccggcgaaactcaggccctt
catgcacctgtcgtggttaatgccgctgggatctgggggcaacacattgccgaatatgcc
gatctgcgcattcgcatgttcccggcgaaaggatcgctgctgatcatggatcaccgcatt
aatcagcatgtgatcaaccgctgccgtaaaccttccgacgccgatattctggtgcctggc
gataccatttcgctgattggcaccacctctttacgtattgattacaacgagattgacgat
aatcgagtgacggcagaagaggttgatattctgctgcgtgaaggggaaaaactggccccc
gtgatggcgaaaacgcgcattttgcgggcctattctggcgtgcgcccgctggttgccagc
gatgacgacccgagcggacgtaacgtcagccgtggcatcgtgctgctcgaccatgctgaa
cgcgatggtctggacggatttatcaccatcaccggtggcaaactgatgacctatcggctg
atggctgaatgggctaccgacgcggtatgccgcaaactgggcaacacgcgcccctgtacg
accgccgatctggcacttccgggttcacaggaacccgctgaagttaccttgcgtaaagtc
atctccctgcctgccccgctgcgcggttctgcggtttatcgtcatggcgatcgcacgcct
gcctggctgagcgaaggccgtctgcaccgtagcctggtatgtgagtgcgaagcggtaact
gcgggtgaagtgcagtacgcggtagaaaatttaaacgttaatagcctgctggatttacgc
cgtcgtacccgtgtggggatgggtacctgccagggcgaactctgcgcctgccgcgctgct
ggactgctgcaacgttttaacgtcacgacgtccgcgcaatctatcgagcaactttccacc
ttccttaacgaacgctggaaaggcgtgcaacccatcgcctggggagatgcactgcgcgaa
agcgaatttacccgctgggtttatcagggactgtgtggtctggagaaggagcagaaagat
gcgctttga

DBGET integrated database retrieval system