KEGG   Escherichia coli O55 H7 CB9615 (EPEC): G2583_2853Help
Entry
G2583_2853        CDS       T01190                                 

Gene name
accD
Definition
(GenBank) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta
  KO
K01963  acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2 2.1.3.15]
Organism
eok  Escherichia coli O55:H7 CB9615 (EPEC)
Pathway
eok00061  Fatty acid biosynthesis
eok00620  Pyruvate metabolism
eok00640  Propanoate metabolism
eok01100  Metabolic pathways
eok01110  Biosynthesis of secondary metabolites
eok01120  Microbial metabolism in diverse environments
eok01130  Biosynthesis of antibiotics
eok01200  Carbon metabolism
eok01212  Fatty acid metabolism
Module
eok_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:eok00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    G2583_2853 (accD)
   00640 Propanoate metabolism
    G2583_2853 (accD)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    G2583_2853 (accD)
Enzymes [BR:eok01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     G2583_2853 (accD)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     G2583_2853 (accD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans zf-ACC DZR OrfB_Zn_ribbon Zn-ribbon_8 CpXC zf-FPG_IleRS Auto_anti-p27
Motif
Other DBs
NCBI-ProteinID: ADD57391
UniProt: D3QL09
LinkDB All DBs
Structure
PDB: 

Position
complement(2900431..2901345)
Genome map
AA seq 304 aa AA seqDB search
MSWIERIKSNITPTRKASIPEGVWTKCDSCGQVLYRAELERNLEVCPKCDHHMRMTARNR
LHSLLDEGSLVELGSELEPKDVLKFRDSKKYKDRLASAQKETGEKDALVVMKGTLYGMPV
VAAAFEFAFMGGSMGSVVGARFVRAVEQALEDNCPLICFSASGGARMQEALMSLMQMAKT
SAALAKMQERGLPYISVLTDPTMGGVSASFAMLGDLNIAEPKALIGFAGPRVIEQTVREK
LPPGFQRSEFLIEKGAIDMIVRRPEMRLKLASILAKLMNLPAPNPEAPREGVVVPPVPDQ
EPEA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagctggattgaacgaattaaaagcaacattactcccacccgcaaggcgagcattcct
gaaggggtgtggactaagtgtgatagctgcggtcaggttttataccgcgctgagctggaa
cgtaatcttgaggtctgtccgaagtgtgaccatcacatgcgtatgacagcgcgtaatcgc
ctgcatagcctgttagatgaaggaagccttgtggagctgggtagcgagcttgagccgaaa
gatgtgctgaagtttcgtgactccaagaagtataaagaccgtctggcatctgcgcagaaa
gaaaccggcgaaaaagatgcgctggtggtgatgaaaggcactctgtatggaatgccggtt
gtcgctgcggcattcgagttcgcctttatgggcggttcaatggggtctgttgtgggtgca
cgtttcgtgcgtgccgttgagcaggcgctggaagataactgcccgctgatctgcttctcc
gcctctggtggcgcacgtatgcaggaagcactgatgtcgctgatgcagatggcgaaaacc
tctgcggcactggcaaaaatgcaggagcgcggcttgccgtacatctccgtgctgaccgac
ccgacgatgggcggtgtttctgcaagtttcgccatgctgggcgatctcaacatcgctgaa
ccgaaagcgttaatcggctttgccggtccgcgtgttatcgaacagaccgttcgcgaaaaa
ctgccgccaggattccagcgcagtgaattcctgatcgagaaaggcgcgatcgacatgatc
gtccgtcgtccggaaatgcgcctgaaactggcgagcattctggcgaagttgatgaatctg
ccagcgccgaatcctgaagcgccgcgtgaaggcgtagtggtacccccggtaccggatcag
gaacctgaggcctga

DBGET integrated database retrieval system