KEGG   Emticicia oligotrophica: Emtol_0622Help
Entry
Emtol_0622        CDS       T02272                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
eol  Emticicia oligotrophica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 3HCDH_N 2-Hacid_dh_C ADH_zinc_N_2 Sacchrp_dh_NADP Pyr_redox_2 Pyr_redox NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AFK01775
UniProt: I2EQ22
LinkDB All DBs
Position
complement(310060..311085)
Genome map
AA seq 341 aa AA seqDB search
MKTIILNQPQELKLIHQDFDDTLAPHEALLKIHRIGICGTDYHAYRGRQPFFSYPRVLGH
ELGAEVIALGSEAQNGGIKVGAKVSVEPYLNCGECQPCKNGRTNCCESLKVLGVHIDGGM
VEYLKVPVNKLHTSEKLAYEQLALVETLGIGSHAVQRANVTEKDIVLVIGAGPIGLSVIQ
FAKINGAKIAVMDFSEQRLAFANQAIGIDVSIVPNENYSADDLRKTLGGNLPTVVFDATG
NAQSMMKAFSYVCFGGKLVYVGLFQGEVTFFDPDFHRREITLLASRNALPADFKHIISKM
ESGEINTKAWLTHEAAFEDLPEIFETWLDPKSQVIKAMVVL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaactatcattttaaaccaacctcaagaactcaaacttattcaccaagattttgat
gatacattagctccgcacgaagctttgttgaaaatccatcgcattggtatttgtggaact
gattatcatgcgtatcgtgggcgtcaaccatttttctcgtatcctcgtgttttagggcat
gaacttggtgcggaagtgattgcattagggagtgaagctcaaaatggaggtattaaagtt
ggagcgaaagtatcagtcgaaccatatttgaattgtggagagtgtcaaccatgtaaaaat
ggcagaaccaactgttgtgagagcctaaaagtattgggtgtgcatattgatggtggaatg
gtagaatatttaaaagtgccagtcaataaacttcatacttctgaaaaattagcttatgaa
caactggctttggttgaaactttagggattggttcgcatgctgtacaaagagcaaatgta
accgaaaaagatattgtattggttattggtgcggggcctattggtctttctgttattcag
tttgccaaaatcaatggtgcaaaaattgcggtaatggattttagcgaacaacgactagct
tttgcaaaccaagctattggaattgatgtaagtattgttcctaatgaaaattattctgct
gatgatttaagaaaaacgttaggtggaaatttacctactgttgtttttgatgccacaggg
aatgcccaatcaatgatgaaggcgttttcttatgtttgctttggcggaaagttagtttac
gttgggctttttcaaggagaagtaaccttttttgacccagattttcatcgaagagaaatt
acacttttagccagtagaaatgccttgcctgctgattttaaacacattatttcgaagatg
gaaagtggggaaatcaataccaaagcatggttgactcatgaagctgcttttgaagattta
cctgaaatttttgagacatggctcgacccaaaatcgcaagttatcaaagctatggttgtt
ttataa

DBGET integrated database retrieval system