KEGG   Emticicia oligotrophica: Emtol_0739Help
Entry
Emtol_0739        CDS       T02272                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eol  Emticicia oligotrophica
Pathway
eol00564  Glycerophospholipid metabolism
eol01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eol00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Emtol_0739
Enzymes [BR:eol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Emtol_0739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_3 FAD_binding_2 NAD_binding_8 HI0933_like Pyr_redox_2 GIDA Thi4 3HCDH_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AFK01891
UniProt: I2EQD8
LinkDB All DBs
Position
464061..465686
Genome map
AA seq 541 aa AA seqDB search
MNRIKNLERLQNEEFDICIIGAGASGAGCALDATLRGFKVALIEKEDFAAETSSKSTKLI
HGGVRYLEQAFKNLDFAQLRQVKHGLEERHTVIRNAPHLAHPLALITPVFSWFEGFYFKI
GLTIYGFFAKNDPMPRAEWLNKKETFEHIPTLTPNLHSSVMYYDGQLDDARYCLALAHSA
DEAGAVVVNHASIVGFSKDAKGKLNEATVLDNLSGNHIQVKAKLFINCTGPHADSIRLMA
NDKQEKRLRPSKGVHIMLPPDVLKSQDAMLIPKTKDGRVVFVIPFEGEVMVGTTDDEYKA
LDKEPILIAQEVDFLLDTLRPYLAKVPDKSQIKSGFGGLRPLIGSSGSKATKKLVRDHEV
EFDEESNLLSLLGGKWTTYRLMAKDTIDEACKILNKQTECSTELHYLVGGENYDFESWRK
IQKDFSLDEATSQHLVKKYGTKARAVLEIGKLTEKIHPSYPFIKAEVIYTVKEEMACSLR
DFFARRTRMELIEWKATLDSVEVVAELMASELNWNEEQKRSQILRYKQLLKTFIDHANTH
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaattaaaaatctcgaaagactacaaaacgaagagtttgatatttgcattatt
ggtgcaggtgcgagcggtgccggctgtgctttagatgcaactttgagaggttttaaagtt
gccttgattgaaaaagaagatttcgctgccgaaacttcttcaaaatcaacaaaactaatt
catggaggtgttagatatttagaacaagcattcaaaaaccttgattttgctcaactccga
caagtaaaacatggccttgaagaacgccatacagtgattcgtaatgctcctcatttggca
catccattggcattaataacacctgtgtttagttggttcgaaggtttttacttcaaaatt
ggtcttactatctacggtttttttgcaaaaaatgatcccatgccacgtgcagagtggcta
aataaaaaagaaacctttgagcatattcctacactaacgcctaatttacatagttcggta
atgtactatgatggccagctcgatgatgctcgctattgcctagctttagctcattcggcc
gatgaagcaggggcagtagtagtaaaccatgcttcgattgttggctttagcaaagatgct
aaagggaaattaaatgaagcaacggtgttggataacctcagtggtaaccatatacaagta
aaggctaagctcttcattaattgtacggggcctcatgctgattctattcgtttgatggcc
aatgataagcaagaaaaacgtttacgaccaagcaaaggcgtgcacatcatgctacctcct
gacgtactcaaaagtcaagatgcgatgcttattccaaaaactaaagatggaagagtagta
ttcgttataccgtttgagggtgaagttatggttggtactaccgatgacgaatataaagcc
cttgataaagaaccaattttgattgctcaagaagtagatttcttgcttgataccctacgc
ccttacttagctaaagtgccagataaatctcaaataaaatctggttttggtggtttacgt
ccactaattgggtcttcaggctcaaaagctaccaaaaaactcgtacgtgaccatgaggta
gaatttgacgaggaatcaaatttgcttagtttactcggtggtaaatggacaacctatcga
ttgatggccaaagatacaattgatgaagcatgcaaaattctgaacaaacagaccgaatgt
agtactgaacttcattatttagtaggtggcgaaaattatgattttgaatcttggcgaaaa
atccaaaaagactttagtttagatgaggctacttcccaacatttggtaaaaaaatatggt
acaaaagcacgggcagttttagaaattggtaaacttactgaaaaaattcacccttcatat
ccattcattaaagcagaggttatatatacagtcaaagaagaaatggcttgtagtttaaga
gatttctttgctcgtcgcacccgtatggagctgattgagtggaaagcaaccctcgattca
gttgaagttgtagcagaactaatggcgagtgaactcaactggaatgaagaacaaaaaagg
tcacaaattttaagatataagcaattacttaaaacctttatcgaccatgccaatactcat
aaataa

DBGET integrated database retrieval system