KEGG   Emticicia oligotrophica: Emtol_1026Help
Entry
Emtol_1026        CDS       T02272                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eol  Emticicia oligotrophica
Pathway
eol00010  Glycolysis / Gluconeogenesis
eol00030  Pentose phosphate pathway
eol00051  Fructose and mannose metabolism
eol00052  Galactose metabolism
eol00680  Methane metabolism
eol01100  Metabolic pathways
eol01110  Biosynthesis of secondary metabolites
eol01120  Microbial metabolism in diverse environments
eol01130  Biosynthesis of antibiotics
eol01200  Carbon metabolism
eol01230  Biosynthesis of amino acids
eol03018  RNA degradation
Module
eol_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Emtol_1026
   00030 Pentose phosphate pathway
    Emtol_1026
   00051 Fructose and mannose metabolism
    Emtol_1026
   00052 Galactose metabolism
    Emtol_1026
  09102 Energy metabolism
   00680 Methane metabolism
    Emtol_1026
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Emtol_1026
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:eol01009]
    Emtol_1026
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:eol03019]
    Emtol_1026
Enzymes [BR:eol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Emtol_1026
Protein phosphatases and associated proteins [BR:eol01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Emtol_1026
Messenger RNA biogenesis [BR:eol03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Emtol_1026
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Alba
Motif
Other DBs
NCBI-ProteinID: AFK02176
UniProt: I2ER73
LinkDB All DBs
Position
complement(803293..804267)
Genome map
AA seq 324 aa AA seqDB search
MKRIAVYTSGGDAPGMNACIRAAVRGAIYHGLEVYGIRRGYNGMIAGDIFPMNSQSVSNI
VQRGGTILKSARSKEFMTPEGRKKAYENLMNLGIEGLVAIGGNGTFTGAEVFYNEYEIPT
VGCPGTIDNDLYGTDYTIGFDTAVNTSLEAIDKIRDTADSHDRVFFIEVMGRDSGYIAIQ
SGIGGGAEIVMVPETHTPLKKVVSTLKDGWSRSKSSSIVVVAEGDEEGHAVDIAEKIKGQ
VADKLDIRVTTLGHIQRGGTPTAYDRILASRLGLGAVEGLIKGYKNVMAGIVNNELVYTP
FIDTIKKPKPIHDDLLRMVHILSM
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaatagcagtttatacatctggaggtgacgcacctggtatgaatgcctgcatt
agagcggcagttagaggtgccatctatcatggtttagaagtttacggaattagaagagga
tataatggaatgattgcgggagatattttcccaatgaactcgcagtcagtaagtaatata
gtgcaaagaggaggtaccatcctgaaatcagcgagaagtaaggagtttatgactcctgaa
ggaagaaaaaaagcctacgaaaacttaatgaatttaggtatagaagggcttgtagcaatt
ggtggaaacggtacatttacaggagctgaggttttctacaacgaatacgaaataccaaca
gttggctgccccggaactattgataatgacctttatggtactgattatacgattggtttc
gatactgcagtaaatacttcacttgaagcaattgataaaattagagatacagccgattcg
catgaccgcgtattttttatcgaagtaatgggccgtgactcaggttatatcgcaatccaa
tcaggtattggtggtggtgctgaaatcgtaatggttcctgaaacacatacaccattgaaa
aaagtggtgagtactctgaaagatggttggtctcgctcaaaatcttcttcaattgtagta
gtagctgaaggtgatgaagaaggccacgcggttgatatcgcagaaaagattaaaggacaa
gtggctgataaattagatattcgtgtaacaacactcggacacatccaacgtggtggtaca
ccaactgcttacgaccgtattcttgctagccgtttaggtttaggagcggttgaagggctt
atcaagggctacaaaaatgttatggcaggaattgtaaacaatgaattggtttatacacca
tttattgatacaatcaaaaaacctaagccaattcatgatgatttattgagaatggtacac
attctaagtatgtaa

DBGET integrated database retrieval system