KEGG   Emticicia oligotrophica: Emtol_1345Help
Entry
Emtol_1345        CDS       T02272                                 

Definition
(GenBank) major facilitator superfamily MFS_1
Organism
eol  Emticicia oligotrophica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 MFS_3
Motif
Other DBs
NCBI-ProteinID: AFK02494
UniProt: I2ES41
LinkDB All DBs
Position
1194824..1196011
Genome map
AA seq 395 aa AA seqDB search
MLSLYRNAFGGLSRQVWLLALVMLINRSGTMVVAFLTLYLTQKLHFSITEAGFVMGIYGI
GSICGTFMGGRLTDKVGYYPVQFWSLLLGGIVFLILVHVENYFVFCGSVFFLSALGEAYR
PANTASIADFSTPETFTRSVSLIRLAINIGWSIGPAIGGFLASRDYTLLFWADGITNVGA
AILVFSFLRTARRKKAAKKADAHEISQKDSVYSDRPYLIFLVLTTLYAMAFFQLFTIGPL
FYKQVCKLSEMQIGYILGINGLIVAFVEMILIYKIEGKFEKLYLISLGAGLVVINYVVFL
LSHDYMWLIVGIIFATFSEIFAMPFMNAFSIERSKPHNRGQYSGLHSMTWSIAQVSAPLI
GTQTIAFLGFDTLWFVLGSFGLISSLGFIWMKRLL
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgctttcactgtaccgcaatgcctttggtggtttatctcgacaagtctggctattagct
ttggtaatgctcattaaccgaagtggcaccatggtagtggcattcctaacgctttatctt
actcaaaaacttcactttagtatcactgaagcaggttttgtgatgggtatttatggcatt
ggctccatttgcggaactttcatgggaggacgcctgaccgataaagttgggtattaccct
gtgcagttttggagcctgctactgggtggtattgtatttttaattctggttcatgttgaa
aattattttgttttttgcgggtcagtattttttttaagtgcattgggcgaagcttatcga
cctgcaaatactgcttcaatagccgattttagcacacccgaaacctttacccgctcagtt
tccttgattcgtcttgccattaacattggttggtcaattggccctgccattggtggtttt
ttagcctcaagagattatactttactattctgggccgatggtatcacaaacgttggagca
gctattttggtattttcttttcttcgtacagctcgtagaaaaaaagcagcaaaaaaagca
gatgcccacgaaattagtcaaaaagattccgtttatagcgaccgcccctaccttatattt
ttggttcttactacactttacgcgatggctttctttcaattattcacaattgggccatta
ttttataagcaagtgtgcaaattaagcgaaatgcaaattggctatattttaggaatcaat
gggctcatagttgcctttgttgaaatgattttgatttataagatagaaggaaagttcgaa
aagctttatctgattagtctgggagcgggtctggttgtaattaactatgtagtattccta
ctttcgcacgattatatgtggctaattgtaggaattatttttgctactttctccgagatt
ttcgcaatgccatttatgaatgcgttcagcatcgaacggtcaaaaccacataatcgtggc
caatattctggtttacattcaatgacttggagtattgcacaagtttctgctcctttgatt
gggacacaaacgattgcttttttaggctttgatactctttggtttgttttaggttcgttt
ggacttatttcctcacttggttttatttggatgaaacgtcttttataa

DBGET integrated database retrieval system