KEGG   Emticicia oligotrophica: Emtol_1992Help
Entry
Emtol_1992        CDS       T02272                                 

Definition
(GenBank) glycosyl transferase family 2
Organism
eol  Emticicia oligotrophica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Anp1
Motif
Other DBs
NCBI-ProteinID: AFK03132
UniProt: I2ETX9
LinkDB All DBs
Position
complement(2002133..2003605)
Genome map
AA seq 490 aa AA seqDB search
MELLFLIIYAIPLVFIFSYSLIQLSLIISYLGSKHSVGNSQSSSYTHTVDGNLPFVTIQL
PIYNERYVVERLIDAITAFEYPKERFEIQVLDDSTDETIEIIAQKVNAYQQLGFQINHIR
RAERTGFKAGALAFGLKKCKGEFIAIFDADFVPPKDFLQETIRHFSSPDVGVVQTRWKHI
NENYSLLTQLQAFGLDAHFTIEQGGRNADKHFINFNGTAGVWRKSTIEDAGGWEADTLTE
DLDLSYRAQMKDWRFVYLENVGCPAELPVTMSAVKSQQYRWTKGAAECVVKNLRKLLTDK
HLGFGTKLHGFYHLMNSAVFVAVLLLSLLSVPMMFLGKDSSVYASFFRYSALFQVSWVIL
GCFYWISFQKTGLGIFEFIKRFVWFLLFMMGLSFHNSVAVVEGWLGKKTPFVRTPKFNVN
TQKDSWRGNIYIVQSINKSTWIELFLMLYFISALIIELSLGQWGLVPFHLMLIVGYGSIL
YYTFLQNRTA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaattattgtttttgataatttacgccattccactggttttcattttttcatatagc
ctaattcaacttagtttaataataagttatttaggaagtaaacattcggttggaaatagt
caatcaagctcatacacccatacggtggatggtaatcttccttttgtaactattcaactt
cctatttataatgaacgatatgtagttgagcgtctgattgatgccattactgcatttgaa
tatcccaaagaaaggtttgaaattcaagttttagatgattcaaccgacgaaacaattgag
ataatcgcacagaaggtaaatgcgtatcaacaactaggctttcagattaatcacattcgt
agagcagaacggactggttttaaagcaggtgcacttgcttttggcttaaagaagtgcaaa
ggagagtttattgccatttttgatgctgattttgttccaccaaaagactttctccaagaa
actatacgacatttttcctcgcctgatgtgggagttgtacaaactcgctggaaacatatc
aacgaaaattattctttacttacgcagttgcaagcttttggcttagatgcccattttacg
attgaacaaggtggccgaaatgccgacaaacactttatcaattttaatggaactgcggga
gtttggcgaaaatctaccatcgaagatgctggaggctgggaagcagatacgcttactgaa
gacttagacctaagctatcgagctcaaatgaaagactggcgatttgtgtatttagaaaat
gtgggctgccctgccgaacttcccgtaacgatgagtgcggtaaagtcgcagcaataccgc
tggacaaaaggagcggccgaatgtgtggtaaaaaatcttcgaaaattattgactgataaa
catttagggtttggcaccaaacttcatgggttttatcatttgatgaatagtgcggtcttt
gttgccgtactattactttcacttcttagtgtaccgatgatgtttttagggaaagattca
agtgtttatgcttcattttttcgttattcggccttatttcaagttagttgggtaatttta
ggttgtttttattggatttcgttccaaaaaactggtttaggaatttttgagtttattaaa
agatttgtctggtttttacttttcatgatgggtttatcgtttcataattcggtggcggtt
gttgaaggctggttagggaagaaaacgcctttcgtacgtacaccaaagtttaatgtaaat
acccaaaaagactcttggcgaggcaatatttacattgttcaaagtatcaacaaaagcaca
tggatagagctttttttaatgctttattttatttctgctttaattattgaattatctctt
gggcagtgggggctcgttccttttcatttgatgctcattgttggctatggaagcatactt
tattataccttcctgcaaaatcgaactgcgtaa

DBGET integrated database retrieval system