KEGG   Emticicia oligotrophica: Emtol_2010Help
Entry
Emtol_2010        CDS       T02272                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eol  Emticicia oligotrophica
Pathway
eol00620  Pyruvate metabolism
eol00680  Methane metabolism
eol01100  Metabolic pathways
eol01120  Microbial metabolism in diverse environments
eol01200  Carbon metabolism
Module
eol_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:eol00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Emtol_2010
  Energy metabolism
   00680 Methane metabolism
    Emtol_2010
Enzymes [BR:eol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Emtol_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 Imm64 NTP_transf_5
Motif
Other DBs
NCBI-ProteinID: AFK03150
UniProt: I2ETZ7
LinkDB All DBs
Position
complement(2026175..2028784)
Genome map
AA seq 869 aa AA seqDB search
MQYVFAYFATQNLNTCTRMPKNSIESVFTQEIHNKYLVFNTLFSRLPYDKMAKIGQLMPF
LHDLSETGFEQGKDPKEIINLFFNQYTTIKDEKERIDLLFRFITYIERQVVLFDSIEDSA
FEKLTPINGKGTLQSTFELAIQQNKIEEVKQKLKNFKVRVVFTAHPTQFYPNSVLRIIQD
LEELIPKNDINGIDALLQQLGKTPFINEQKPTPLEEAQSIIFYLRHVYYQVIGEIHQKIN
NYLQTEESEFSPVLELGFWPGGDRDGNPFVTADISKKVAQELRSSILKCYYNDFKIVCRR
LTLKGIMPLLTQISNRIHTNMNGLKNDLTLEELLASLYEVRDLLITKHNSIFLDLFDRFI
QQVKLFGLHFASLDIRQDSSIHEKVMDEINQKYAISPKPYSEWTHAEKLHFLTEHELLIN
EDDFEDPLTKDTFKTVKAIKEIQTLNGEKACHRYIISNSTSMFSVLEVLALFRFCGITPS
EVNVDVMPLFETIEGLDNAQSTMSALYQLPFYKAHLEHRKNHQTIMLGFSDGTKDGGYVK
ANWEIYQAKEKLSRVSKKNQIEVMFFDGRGGPPARGGGKTHQFYASQGPTIANNEIQVTI
QGQTITSMYGSRPQAMYNFEQLISAGIINDVFHDDRSILDKKERVLIDELAEEGVRKYFE
LKEHPLFVSYLENKSPLKYYGLTNIGSRPSKRSSGKKLMLSDLRAIPFVGSWSQLKQNVP
GYFGFGSAMQKVIEEGRLEDLKSLYQSSLYFKTLMENSMMALTKTYFPLTKYMKNDPEYG
AFWNILYEEYLLSVKNMLLVSGQSELMANETLGKMSINYREHIVLPLLTIQQYALQRIEE
TKDEKLKLVYEKMVTRSLFGNINASRNSA
NT seq 2610 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatgtttttgcgtattttgctacacaaaaccttaatacttgcacaagaatgcct
aaaaattcaatcgaatcggtttttacacaagagattcacaacaaatatcttgtattcaac
acgcttttttcgaggctcccttacgataagatggcaaagattggtcaattaatgccattc
cttcatgatttatcggaaactggttttgaacagggtaaagaccctaaagaaatcatcaat
ttattcttcaatcaatacaccactatcaaagacgaaaaggaaagaatagaccttcttttc
cgcttcattacttacattgagcgtcaggttgtattatttgatagtattgaagattctgct
tttgagaaacttacgccgattaatggaaagggaacgctccaaagcaccttcgaattggcg
attcagcaaaataaaattgaagaagtaaagcaaaaactcaaaaacttcaaggttcgtgta
gtatttacggctcaccctacgcaattttacccaaatagtgtgttgcgtattattcaagat
ttggaagagttgatacctaaaaatgatatcaatggtattgatgctttgctgcaacagctt
ggtaaaacaccttttatcaacgagcaaaagcctacaccgcttgaagaagcccaaagtatc
attttttatcttcgtcacgtttattatcaagtcattggtgagattcatcagaaaatcaat
aattatttacaaactgaagaatcagaatttagccctgtacttgaattaggtttttggccc
ggtggcgaccgcgacggcaatccatttgtgacggccgacatttctaagaaagtagctcaa
gaattgcgttcaagcattttgaagtgttattacaacgatttcaagattgtttgtcgccgc
ctgacactcaaaggtatcatgccactactgacacaaatcagtaatcgtattcacacgaat
atgaatggcctgaaaaatgacctcacgctcgaagaactccttgcatcgctatatgaagtt
cgtgatttgctcattacgaagcataattctattttcttagacctttttgatagatttatc
caacaagtaaagctattcggactacattttgcgagcttagatattcgtcaagatagtagt
attcatgaaaaagtaatggatgaaatcaaccaaaaatatgccatttctccaaagccttat
tctgaatggactcacgcagaaaaacttcatttcttgacagagcatgagttactaatcaat
gaagatgattttgaagacccgcttactaaggataccttcaaaacagtaaaagcaatcaaa
gaaattcaaaccctcaatggcgagaaagcttgtcaccgatatatcatcagtaactctact
tcaatgttctcggtgttagaagttttggctcttttcagattctgcggtatcacaccttca
gaggttaatgttgatgtaatgcctcttttcgagaccatcgaaggtttagataatgcccaa
tcaaccatgtcggctttatatcaattaccattctacaaggctcatttagaacaccgcaaa
aatcatcaaacgattatgcttggtttctctgatggcacgaaagatggaggatacgtaaaa
gcaaactgggaaatctaccaagcgaaagaaaagctttcgagagtatcgaagaaaaatcaa
atagaagtaatgttcttcgatggtcgtggtgggcctccagctcgtggcggtggaaaaact
caccaattttatgcttcgcaagggccaactatcgccaataatgaaatacaggtgacaatt
caaggccaaaccattacttcaatgtacggctctcgcccacaagcgatgtataatttcgaa
cagttgatttccgcaggtatcatcaatgatgtattccacgatgataggtcaattttagac
aaaaaagagcgtgtattaattgatgaattagcagaagagggtgtaagaaaatatttcgaa
cttaaagaacacccactttttgtttcttacctcgaaaacaaaagtccacttaaatattat
ggtttaaccaatattggtagccgtccaagtaaacgaagttctggaaagaaacttatgctt
tctgacctccgagccattccgtttgttggttcgtggagtcaattaaagcagaatgttcca
ggatattttggatttggctctgctatgcaaaaagttatcgaggaaggtcgtttagaagat
ttgaaatcgctctatcaaagctcgctatatttcaagacattgatggaaaatagtatgatg
gctttaactaaaacctatttcccattgaccaaatacatgaaaaacgacccagaatatggt
gcgttttggaatatcttgtatgaagaatatttactttctgtaaagaatatgcttttagtt
tcggggcaaagcgaattgatggcaaatgaaactttaggtaagatgtcaatcaattatcgt
gagcacattgtattgcctttactaacgattcagcaatatgctttgcaaagaatagaagag
actaaagacgagaaactaaagttagtttacgaaaaaatggttactcgctctctatttggt
aatatcaatgcgagtcgaaactcagcataa

DBGET integrated database retrieval system