KEGG   Emticicia oligotrophica: Emtol_2810Help
Entry
Emtol_2810        CDS       T02272                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
eol  Emticicia oligotrophica
Pathway
eol00473  D-Alanine metabolism
eol01100  Metabolic pathways
eol01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eol00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Emtol_2810
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Emtol_2810
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eol01011]
    Emtol_2810
Enzymes [BR:eol01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Emtol_2810
Peptidoglycan biosynthesis and degradation proteins [BR:eol01011]
 Precursor biosynthesis
  Racemase
   Emtol_2810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Mur_ligase_M Mur_ligase Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AFK03945
UniProt: I2EW92
LinkDB All DBs
Position
2995602..2998076
Genome map
AA seq 824 aa AA seqDB search
MNFLSEPIITQASVLLTDSRLVSQPEHSVFFAIKGEHHDGHAFVAELYNKGVREFVVEKK
AMSEAFVAELSTLTDAKIYLVENAIRALQNLVAKHRQKFDIPVIGVTGSNGKTIVKEWLS
VLLAKDYNLVKSPRSYNSQIGVPLSVWELNENHNLGIFEAGISKSGEMEFLEPVIRPTIG
IFTNIGSAHDEGFRSRKQKATEKLRLFQRCQVLIYCKDYEDIDDEIRILLKAVNPKIKLI
DWSRKAGSKTFVNVTKFATYCTLQILWNGQIHDFKIPLADDASIENATHCIFLMLHLEIP
NGDIQSRLDWLKPVAMRLELKQGINDCYLIDDSYNNDYAGLAVALNFMIQQHTKRDKVLI
ISDVLQSGLEENELYESIAELVRGKKIDKVIGIGEVIYRNQKAFYTPNLEDKKTVFYQST
QEFLEKYPINQLQSSLILVKGARKFEFEKIINRLTLKVHGTVFEVNLDALTNNLNFYRNK
IGLGTKIMVMVKAFAYGSGSAEVASLLEYHKVDYLGVAYTDEGVVLRQNGIKLPIMVLNP
QPESFAKLVEYNLEPEIYSFKLFEQFLNFTNRFTNKIFKIHLKIDTGMHRLGFVEQDIIS
VIDLLNQNPTIQVASIFSHLVGADESEHNAFSKLQIEKFEQMSQQILAAIPRQKPLRHIC
NSAGIIRFPEAKFDMVRLGIGLYGVEVTGVEQNALQTVGTLKTVISQIKHLQAGTTVGYS
RKGVLERESKIATIAIGYADGFDRGFSKGVGKVLVNGVACPVVGNVCMDMTMIDVTDVEC
EEGDEVIIFGKDLSITELAQTIDTIPYEILTGVSERVKRVFFKE
NT seq 2475 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttcctttccgaaccaattattactcaagcatcggtattacttactgatagccgt
ttggtatctcaacctgaacacagtgttttttttgccattaagggtgaacatcatgatgga
catgcttttgtagcagagctttataacaaaggtgtaagagaatttgtggttgagaaaaaa
gccatgtcagaggcctttgtggccgaactatctactttgactgatgctaaaatatactta
gtagaaaatgctattcgtgccttgcaaaacttggtagcaaaacaccgccaaaaatttgat
attcctgtaattggtgtaacgggtagcaatggaaaaacaattgtaaaagaatggctaagt
gtattattggccaaagattataatttagttaaaagtccgcgtagttataattctcagata
ggtgttccactatcggtttgggaattaaacgaaaatcacaatttaggtatttttgaggct
ggcatttcaaaatctggcgaaatggagtttctcgaaccggttattcgtccaaccattggc
atttttacaaatattggttcggcacacgatgaaggttttcgaagtagaaagcaaaaagct
accgaaaaacttcgcttatttcagagatgccaggtattgatttattgtaaggactatgaa
gatattgatgatgaaatcagaattttattaaaagcggtaaatcccaaaattaaattaatt
gattggtcaagaaaggcaggaagtaaaacttttgtgaatgtaacgaaatttgcaacatac
tgtactttacaaattctttggaatggtcaaatccatgattttaagattccattagctgat
gatgcttcgattgaaaatgctactcattgtattttcttgatgcttcatttggagattcca
aatggtgatattcaatcaagattagattggttaaaacctgtagctatgcgtttggaatta
aagcaaggtatcaatgattgttatttaattgatgattcttataataatgattatgcaggt
cttgcagtggcattgaattttatgattcaacaacacacaaaacgagataaggtgctgata
atcagtgatgttctgcagtcaggtttagaagaaaacgaattgtatgagagtattgcagaa
ttagtaagaggaaaaaaaatagataaagtaataggaataggggaggtaatttacagaaat
caaaaggcattttacacgccgaaccttgaagataaaaaaacggtattctatcaatctacc
caagaatttcttgaaaaatatccaatcaaccagcttcaaagttcattgatattggtcaaa
ggagcaagaaagtttgaatttgaaaaaattatcaatcgccttacacttaaggtacacggt
actgtctttgaggtaaaccttgatgccctcactaataatctcaatttttaccgaaataaa
atagggctgggtactaaaattatggtaatggtaaaagcatttgcctatggcagtggaagt
gctgaggtagcaagcttactcgaataccacaaagttgattatttaggcgtagcttatacc
gatgaaggcgtggttttgcgtcaaaatggcattaaattgccaattatggtattaaatcct
caacctgaatcatttgccaagttggttgaatataacttagaacccgagatttatagcttc
aagctttttgagcaattcttgaattttaccaatcgttttactaataaaatttttaaaatt
catctcaaaatcgacacgggaatgcaccgtttgggttttgtggagcaagatattatttcg
gttattgacttactcaatcaaaatcctactattcaagtggcctcgatatttagccattta
gtaggagcagacgaaagcgagcataatgctttctcgaaactgcagattgagaaattcgag
caaatgtcgcaacaaattttagctgcaataccgagacaaaaaccgcttagacatatctgt
aattcagctggaattatccgtttcccagaagccaaatttgatatggttcgccttggtatt
ggcctctatggagtggaagttacgggagtagaacaaaatgcattacagaccgttgggacg
ctcaagaccgtaatttctcagattaaacacttgcaagcaggcacaacggttggatatagc
cgaaaaggggtattagaaagagagtcgaaaattgcaacgattgctattggttatgccgat
ggtttcgaccgtggttttagtaaaggcgttggcaaagtattggttaatggcgtagcgtgc
cctgtcgttggaaatgtctgtatggatatgaccatgattgatgtaaccgatgtagagtgt
gaggaaggtgatgaagtaataatttttgggaaagacctttcaattacagaattagcccaa
acgattgatacaattccgtatgaaattcttacgggcgtaagtgaacgagtaaaaagggtt
ttctttaaagaataa

DBGET integrated database retrieval system