KEGG   Exaiptasia pallida: 110232072Help
Entry
110232072         CDS       T05080                                 

Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial-like
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
epa  Exaiptasia pallida
Pathway
epa04068  FoxO signaling pathway
epa04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:epa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    110232072
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110232072
Enzymes [BR:epa01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110232072
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 110232072
NCBI-ProteinID: XP_020892835
LinkDB All DBs
Position
Unknown
AA seq 224 aa AA seqDB search
MLSRARSGLSKLTNFSPAVLNVAVKGKHTLPDLAYDYDALEPTINTEIMRLHHSKHHATY
VNNLNVAEEKYAEAMAKGDTSAVIALQPALKFNGGGHINHTIFWTNLSPSGGGEPTGELM
EAIKKDFGSFENFKXRFNAATIAVQGSGWGWLGYDKVNKRLAISTCFNQDPLQATTGHIP
LLGIDVWEHAYYLQYQNVRPDYVKAIYDVIDWTNVADRYIAAAR
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgctttccagggcaagatctgggcttagcaagttaacgaatttttctccagctgtctta
aatgtagctgtaaaagggaaacatactctccctgacctggcgtacgactacgatgcattg
gagccgacaataaacactgaaattatgcgcctccatcacagcaaacaccatgcgacctat
gtgaacaaccttaacgttgcagaggagaaatatgcagaggcgatggccaaaggtgacaca
tcagcagtcatagcattacagccagctttaaaattcaacggtggtgggcatatcaatcac
actattttttggacgaatttgtctcctagtggtggtggtgagcctacaggtgaactgatg
gaagccattaaaaaggactttggttcatttgaaaattttaagraaagatttaatgctgca
acaatcgcagtgcaaggttcgggatggggatggctgggatatgacaaagtaaacaaaaga
cttgctatcagcacttgttttaaccaagatcctttgcaagcaactacaggccacattcca
ttgcttggtattgatgtgtgggagcatgcctactatctccagtaccagaatgttcgacca
gactatgtgaaagccatttatgatgttatagactggaccaatgttgctgatcgatacatc
gctgccgctaggtag

DBGET integrated database retrieval system