KEGG   Exaiptasia pallida: 110233821Help
Entry
110233821         CDS       T05080                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
epa  Exaiptasia pallida
Pathway
epa00020  Citrate cycle (TCA cycle)
epa00190  Oxidative phosphorylation
epa01100  Metabolic pathways
epa01200  Carbon metabolism
Module
epa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
epa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
epa_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    110233821
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    110233821
Enzymes [BR:epa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     110233821
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 FAD_binding_3 HI0933_like DAO
Motif
Other DBs
NCBI-GeneID: 110233821
NCBI-ProteinID: XP_020894807
LinkDB All DBs
Position
Unknown
AA seq 664 aa AA seqDB search
MWLSKLKTSRLIHPSKVLGLGSTAIRATCSXNFHFKIEGRKGENKTSKSDIAREYPVVDH
SYDAIVIGAGGAGLRAAFGLAQEGFKTACITKLFPTRSHTVAAQGGINAALGNMEPDDWR
WHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTEKGEIYQRAFGGQSYDY
GKGGQAHRCCAVADRTGHSLLHTLYGQSLRYDCEYFIEYFALDLLMDNGKCVGCIALCAE
DGSLHRFKANNTVMATGGYGRAYFSCTSAHTCTGDGTAMVTRAGLPNQDLEFVQFHPTGI
YGAGCLITEGSRGEGGYLINSEGERFMERYAPTAKDLASRDVVSRAETIEIREGRGVGPN
KDHIYLQLSHLPPETLKTRLPGISETAMIFAGVDVTRDPIPVLPTVHYNMGGIPTNFKGQ
VVTHKDGQDVVIDGLWAAGEAACASVHGANRLGANSLLDLVVFGRACARFIAEESKPGEV
LPELKQTAGEESVANLDKVRHANGNTPTAELRLKMQKIMQENAAVFRTGPVLDEGCKLID
DVYQQLSDLKLYDRGMVWNTDLIEALELQNLLLNSIQTIQSAAARNESRGAHSREDYKDR
LDEYDYSKPLEGQTKKPYDQHWRKHTLSWVDSSSGKTTLDYRPVIDETLDQKQCATVPPA
VRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtggctttcgaagcttaaaacctctcgtttaatacacccttccaaggttttaggcttg
gggagtacggcaatccgtgcgacatgtagtaraaattttcatttcaagatcgaaggaaga
aagggagaaaacaagacatccaaaagcgatattgctcgagaatacccagtggtagatcac
tcctatgatgctattgttattggtgcyggyggwgctggattgcgagctgcatttggyttg
gcmcaagaaggatttaagacagcrtgtattacaaaactrttccctaccagatcacatact
gtagctgctcaagggggaatcaatgcagcacttggtaatatggaacctgatgattggaga
tggcacatgtatgacacggttaaaggtagtgactggcttggcgaccaggatgcaatccat
tacatgacagaagaagccccaaaagcagtgatagagctcgaaaattatggtatgccattc
agtcgaacggaaaagggagaaatctaccagagagcatttggtggtcaaagttacgactat
ggtaagggtggccaggcacatcgatgctgtgctgtagctgacagaactggccactctcta
cttcataccttatatggrcagtcattgcgatatgattgtgaatattttatcgagtacttt
gccttggatttgttgatggacaatggcaaatgtgttggttgtatagcactatgtgctgag
gatggctcacttcacagattcaaagcaaacaacactgtcatggccacagggggatatgga
cgtgcatatttctcatgcacctctgcacatacctgcacaggcgatggtactgccatggtt
acacgggctgggctgcctaaccaggacttggagtttgtacagtttcatccgactggtatc
tatggagcaggatgtttaatcactgaaggttcaagaggcgaaggaggatatttgatcaac
agtgagggtgaacgtttcatggaaagatatgcaccaacagctaaagatcttgcatcaaga
gatgttgtctccagagctgaaacaattgaaataagagaaggaaggggagttggcccaaat
aaagaccatatttaccttcaattgtcacacttaccaccagagacactcaaaactcgctta
ccaggaatctcagaaaccgccatgatatttgctggtgttgaygtgacaagagatccaatc
ccagtccttcccacagtgcactacaacatgggtggaatcccaactaacttcaagggtcag
gtcgtcacacataaggacggtcaggatgtagttattgatggtctgtgggctgcgggtgaa
gcagcctgtgcatctgtccatggtgcaaaccgtttaggtgccaattccctactagatctt
gttgtatttggccgtgcttgtgcwagatttattgcagaggagagcaaacctggtgaagtc
ttgcctgaacttaaacagactgcaggagaagaatcagttgcaaaccttgacaaagtccgc
catgcaaatggtaacactcccacagcagagttgagactcaaaatgcagaagattatgcaa
gaaaatgctgcagtattcagaacaggacctgtgcttgatgaaggatgcaaacttattgat
gatgtataccaacagcttagtgacttgaagttatatgaccgtggcatggtatggaacact
gaccttattgaggcactagaactacaaaatttactactgaactcaatccagaccatacag
agtgctgcagcaaggaacgagagcagaggtgcacactcaagggaagattacaaggatcgt
ttrgatgagtaygactattcaaagcctcttgaaggacaaacaaagaaaccttacgatcaa
cattggagaaaacacacgctgtcctgggtagactcgtcatccggcaagactacgctagac
taccgtccagttattgacgaaactctggaccagaagcagtgtgctacggtaccaccagca
gtccggtcctactaa

DBGET integrated database retrieval system