KEGG   Exaiptasia diaphana: 110235270
Entry
110235270         CDS       T05080                                 

Definition
(RefSeq) neuropeptide FF receptor 2-like
  KO
K04291  lysophosphatidic acid receptor 2
Organism
epa  Exaiptasia diaphana
Pathway
epa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:epa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110235270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:epa04030]
    110235270
G protein-coupled receptors [BR:epa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    110235270
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF1218
Other DBs
NCBI-GeneID: 110235270
NCBI-ProteinID: XP_020896378
LinkDB
Position
Unknown
AA seq 272 aa
MQIFGWAFILEAVAITAVNAATIVIFTRTNRLHSKQYIMIISQAVADLFVGLVAIPVFGV
SLALNEDPRTSSTFKQVFLTTDSLFVVASMVGLAALAIERAHATYFPFRHSTLSKGPYII
GIILMWAAPISVAVLYTIFDPPDAVNSKLAVTVLAVVIIVSAYSLIVFKVRYRTTQAHDV
TIQENKKLTVTLAVVTTLSLVMWLPFQCLGMAGVLKGSSPFIYFPAKFLQYGNSLVNSVV
YAFRMREIKREILRTFLCCRNNQISINNETLP
NT seq 819 nt   +upstreamnt  +downstreamnt
atgcagatctttggatgggcattcatcttggaagcagtcgccattacagccgtcaatgct
gcaaccatcgtcatattcaccaggacgaaccgtcttcacagcaaacagtacattatgatt
atcagccaggctgtagctgatctctttgttggtctagtggctattccagtgtttggtgtt
tcacttgcactaaacgaagatccacgcacctcttcgacgtttaaacaagtgtttcttacg
acagatagtctgtttgtagtagcttccatggttggtttggcagcgttggccattgaacga
gcacatgcaacatactttccattcagacactccacattatctaaaggaccgtacatcatc
gggataattttgatgtgggcagctccaatctccgtggctgttctatataccattttcgac
ccgccagatgcagtaaacagcaaacttgcagttactgttcttgcagttgtaataattgtt
tcagcttattctctcatcgttttcaaagtccgctaccgaaccactcaagcccatgatgta
accatccaagaaaacaagaaactgactgtcactcttgctgttgtaactacactaagtctg
gtcatgtggctgcccttccaatgcctgggaatggctggtgtcctcaaaggttcttctcct
ttcatctactttcctgcgaaatttctccaatatggcaactcgctcgttaattccgttgtc
tacgcktttcgtatgcgtgaaataaaaagagaaatcttgcgtacattcctgtgctgtcga
aacaatcaaatctcgataaataacgaaacactgccttag

DBGET integrated database retrieval system