KEGG   Exaiptasia diaphana: 110236145
Entry
110236145         CDS       T05080                                 

Definition
(RefSeq) fibroblast growth factor 1 isoform X1
  KO
K18496  fibroblast growth factor 1
Organism
epa  Exaiptasia diaphana
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:epa04052]
    110236145
   00536 Glycosaminoglycan binding proteins [BR:epa00536]
    110236145
Cytokines and growth factors [BR:epa04052]
 Growth factors
  Growth factors (RTK binding)
   110236145
Glycosaminoglycan binding proteins [BR:epa00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   110236145
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 110236145
NCBI-ProteinID: XP_020897296
LinkDB
Position
Unknown
AA seq 175 aa
MIKSVHIYSILLVMVVIPLSLAKPLSFQEDKVINKIVKLNNVTRWKTIRKAVLDSRYRYR
LEILPSGTVRGTXNYQSIYTQLELHSIGHGIMRIYGVHSKRYLSINDRGQLIGQKQPSLN
TVFKELYLENYYQSFQSYKFKDKNPDSWLVGIKKNGKAKRATATQIGQTSTQFVE
NT seq 528 nt   +upstreamnt  +downstreamnt
atgatcaagagtgtacatatatatagcatactattggttatggttgtcatcccactatcc
ttagcgaagcctctgtcatttcaagaagataaagttattaacaagatagtcaaattgaac
aatgtaactagatggaagacgatacgaaaagctgtactggatagtcgatatcgctacaga
ttagaaatattacccagcgggacagtacgcggtactwccaactaycaatcaatatacact
cagctagaactacactcaataggacatgggataatgaggatatatggagtacattctaaa
cgatatcttagtattaatgacagagggcaattaataggccagaagcaaccatcgctaaat
acagtattcaaggaattatatctggagaactattaccagtcattccaatcatacaaattc
aaagacaaaaatcctgactcatggttagttggtattaaaaagaatggtaaagcaaaaaga
gcaactgcaactcaaataggccaaacatcaacacagtttgttgaatag

DBGET integrated database retrieval system