KEGG   Exaiptasia pallida: 110237636Help
Entry
110237636         CDS       T05080                                 

Definition
(RefSeq) lysosomal alpha-glucosidase-like
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
epa  Exaiptasia pallida
Pathway
epa00052  Galactose metabolism
epa00500  Starch and sucrose metabolism
epa01100  Metabolic pathways
epa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110237636
   00500 Starch and sucrose metabolism
    110237636
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    110237636
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epa04147]
    110237636
Enzymes [BR:epa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     110237636
Exosome [BR:epa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   110237636
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 110237636
NCBI-ProteinID: XP_020898902
LinkDB All DBs
Position
Unknown
AA seq 706 aa AA seqDB search
MIFEDQFLQISSKLSSSNLYGLGEHVDPLKLNMTWRMDTLFARDVATPVGLQENLYGVHP
FYMNIEDDGNANGVFLLNSNALEIILQPLPAITYRSIGGIMDFYVFLGPSPEQVIQQYTA
VIGKPYLPPYWGLGYHLCRWGYGSLERTIQVNSNMRAKGIPQDVQWNDIEYMRDHLDFTV
DPSKWNGLGDFVKKIQSQYNQHYIPIVDPGISNTQPSGSYKPYSDGLSMDVFVKTTEGQP
LVGQVWPGNTVFPDFFSKNAQQYWTEQLSAFHDEVPFDGLWIDMNEPSNFVEGSTSGCPA
SKWDSPPYTPHIIGNTLKSKTICMSANQNGYRHYDVHSLYGYSETVATMKALETVRGKRS
VVISRSTYPSSGQHGGHWLGDNFAQWNSFRYSIPGILNFNLFGIPLVGADICGFIGNTNF
ELCARWTQLGAFYPFSRNHNTINNQPQDPTAFGDNFAAMARNVLLMRYRLLPYLYTLFAN
AHVNGGTVARPLFFEFTNDSKTLPIDQQFMWGSSLLITPVMQQGATSVQGYFPDATWYDA
YSGAELQRKGSGRQYHTLECPVLCNTPLHYRGGSIITTQQPAITTADSRKNPFELIVALS
GQDGVPAKGEVFIDDGESLGPVTKAPYLHVDFVADHALHSSVDPKSSYTPEAKLANITFY
GFGHKPSSVTVNGHAISTYTYDDGLKVLKITGLQLSLDQPFNVTYD
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgatcttcgaggatcagttcctgcagatctcatctaaactctcatcgtctaacctgtat
ggtctaggagaacatgttgatcctcttaaactgaacatgacatggagaatggacactctg
tttgcgagagatgtagcaacaccggtgggcctccaggagaatctgtatggtgttcatcca
ttctatatgaacattgaagatgatggcaatgctaatggagtgtttctattgaacagcaat
gccttagagattatccttcaaccattaccagcaataacctaccgctccatcggtggtata
atggatttctatgtgtttcttggcccgtctccagagcaagttattcagcagtacacagcg
gtcataggaaaaccttaccttcccccgtactggggcttaggctaccatctatgtcgatgg
ggytatggaagtctggagagaactattcaagtaaatagtaacatgcgtgcaaagggaatt
cctcaagatgtacagtggaatgatattgaatacatgcgagatcaccttgattttactgtg
gatccttctaagtggaatggactgggagattttgtaaagaaaatccaaagtcagtacaat
caacactatattcccatcgtggatcctggcattagtaatacccaaccaagtggatcatac
aagccatacagtgatggtttgtcaatggacgtgtttgtaaagaccacagaaggacagcca
ctagtaggacaggtttggccagggaacactgtattccccgacttcttcagcaaaaatgca
cagcagtactggacagaacaattatcagcatttcacgacgaggtaccttttgatggactc
tggattgacatgaacgagccctcaaactttgtggaagggtcgacaagtggttgtcctgca
tcaaaatgggatagtcctccttacactccacatatcattggaaatacattaaagagcaag
acgatatgtatgtctgccaatcaaaatggatatcgacactatgacgtacacagtctctat
ggttatagcgagactgtggcaacaatgaaggctctagaaactgtccgtggcaaaagatca
gtcgtgatttctcgatccacctatccgagcagcggtcaacatggcggacactggctgggt
gataactttgcacaatggaatagctttcgctattcaataccaggaattttgaatttcaac
ctttttgggataccgttggttggtgcagacatttgcggctttattggaaatactaacttt
gaactttgtgcaagatggactcaacttggagcattttatcccttttcaagaaatcataac
acgatcaacaaccagccacaggatccyactgcctttggtgacaattttgcagcaatggct
cgtaacgtgctattaatgagataccgtcttcttccatatttgtacacgttgtttgccaac
gctcatgtaaacggcggtactgtagcaagacckttattcttcgaatttacaaacgatagc
aaaacacttcccatcgatcagcagttcatgtggggctcgtcgcttctaataactcccgtc
atgcaacagggagcgacgagcgttcaagggtacttccccgatgccacgtggtatgacgca
tatagtggtgctgagttacagcgtaaaggtagcggtagacaataccatactcttgaatgc
ccagtgttgtgtaatacaccgctacactaccgtggaggctcaataataacgacacaacaa
cccgcaataacaacagctgatagccgcaagaaccccttcgaacttattgttgctctgtca
ggacaagatggcgtaccagcaaagggagaggttttcatagatgatggggaatctcttggc
cctgtcacaaaagctccataccttcacgtcgattttgtagcagaccatgcactacattca
tctgtggaccctaagagttcctacacgcctgaagctaaactcgccaatataactttctac
ggatttggacataaaccctctagygtgacggtgaatggtcacgcaatctctacgtacaca
tatgatgacgggctcaaggtgctcaagataactggattacagctctctcttgatcagcca
tttaatgtcacttacgattaa

DBGET integrated database retrieval system