KEGG   Exaiptasia pallida: 110239595Help
Entry
110239595         CDS       T05080                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
epa  Exaiptasia pallida
Pathway
epa00052  Galactose metabolism
epa00500  Starch and sucrose metabolism
epa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    110239595
   00500 Starch and sucrose metabolism
    110239595
Enzymes [BR:epa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     110239595
    3.2.1.20  alpha-glucosidase
     110239595
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 110239595
NCBI-ProteinID: XP_020900982
LinkDB All DBs
Position
Unknown
AA seq 930 aa AA seqDB search
MRALTMKALTLIMACILLAQVDAESNEAERFDCYPEGGNQTLCEARGCQWLPSKTKGAPA
CFYKQGYQAGYELKGDPQQNTTXLGYKLNLKRIPYSSLYGNDIDDVVLEIEFQTENRIRF
KFYDANTERYEVPIKMPKANEKASSMNYEVKFVKKKPFAMQIIRKDTKAVLWDSSVGLFV
FSDQFLQISTKTASSNVYGIGEQEHPSFRHDMNWKTWPIFTRDQFPFNGGNAYGHHVFHM
CLEEDGKAHGVFLLNSNAMEMVLQPLPAITYRTIGGILDFYLFLGPTPEAVVSQYTESIG
RPLIPPYWSLGFQLSRWGYNSLKRVKELVEGMRKYDIPQDVQYGDIDYMVRQLDFTYDQN
SYAGLPEFVRSVKKDGLRYIIILDPAIGANETKPYKPYDMGNTMDIWVKDNDGNTLFGKV
WPTFENVTVNGSLPWDEQTRLYRQWATFPDYFHQRAKEYWGDLIKEFHKQIEFDALWIDM
NEPANFVPGAVNGCPKTXWDYPPYKPKSVYGPVLADKTLCMSAKHAGNKLHYDLHSLYGW
KQSIVTDEILKEMLNKRSLVLSRSTFASSGKYAGHWLGDNVARWDQLHASIIGMLEFNFF
GIPYVGADICGFFDHPSAEMCERWMQLGAFYPFSRNHNGFGNNAQDPAAFGPDFAKSARK
VLXTRYTLLPYLYTLFYESRKSGATVVRSLMAEFTSDKTXWDIDRQFLWGPALLISPVLD
KGKTSVEAYFPDARWYDYYTGQESSHRKERSTLDAPLDHINLHVRGGHVIPTQEPANNTM
FSRKNKMGLIIALCDKHTAKGQLFWDDGESIDTFENGKYLLDDISAEKNSVKIKVSKAGY
AGAKGLVWGSVKIYGAGGDKLRSVQANGXDITSKSSXSSKTKALTINXLDLDITQSHEIK
WDVVTSSSADLSKPWLTLMSLMTLLSVFGR
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgagggcactaacgatgaaagcgctcacactaataatggcttgtattttgcttgcacaa
gttgatgcagaatcaaacgaggcagaacgtttcgactgctatccagagggtggaaatcag
acgttatgtgaagcgcgtggatgccagtggctcccttcaaaaaccaagggagcacctgca
tgcttctataaacaaggytatcaagctggatacgagctgaaaggagacccacaacaaaat
acaacargccttggatataagttaaatttgaaacgtattccctactcctccttatatggc
aatgacatcgatgacgttgtacttgaaattgagtttcagacggaaaatcgaattcgtttt
aagttttatgacgcaaatacggaaagatacgaagtgccaatcaagatgccgaaagccaat
gaaaaagcatctagtatgaactacgaagtaaagtttgtcaaaaagaagccttttgccatg
cagataatcagaaaagacaccaaagctgtactatgggattcctccgttggattgtttgta
ttcagcgaccagtttcttcaaatctcaaccaaaacagcgtcaagcaatgtgtatggtatt
ggtgaacaagaacatccttcgtttcgacatgacatgaactggaaaacatggccaatattc
acgagagatcagttcccatttaatggtggtaatgcgtacggtcatcatgtatttcacatg
tgtcttgaagaagatgggaaagctcatggtgtctttctattgaacagtaacgctatggaa
atggtgcttcaacctctgccagctattacgtaccgcaccattggaggtattctcgacttc
tatttgtttcttggaccaacaccagaagccgttgtcagccagtacactgagtcaattggg
cgaccgctgatcccaccgtactggtctcttggattccagttaagccgatggggatataat
agtctaaaaagggttaaagaactcgttgaaggcatgcgcaaatatgacataccgcaggat
gtccaatatggcgacatagattacatggttcgtcaacttgacttcacctacgatcaaaac
agctatgctggtttgcccgagtttgttcgatcagttaagaaagacggcttgaggtacatt
attatactggatccagcgattggtgctaatgagactaagccatacaaaccttatgacatg
ggaaatacgatggatatatgggtgaaagacaacgatggaaacacgctgtttggaaaggtc
tggccaacttttgaaaacgtcaccgtgaatggtagcttaccttgggatgaacaaactcga
ctttatcggcaatgggccaccttcccagattactttcatcagcgtgctaaagagtactgg
ggtgacctgataaaggagtttcacaaacaaatagaatttgacgctttgtggattgacatg
aatgagcctgcgaactttgttcctggtgcggttaatggttgtcctaaaactaastgggac
taccctccctacaagcctaaaagtgtatatggaccggtccttgccgataaaacgttatgt
atgagcgcaaagcatgctggtaacaagcttcactatgatcttcacagtctgtatggatgg
aagcagtccatcgtcaccgatgaaatcctcaaagaaatgttaaataaacgaagtttagta
ctttctcgttcgacgttcgccagcagcggaaaatacgcgggtcactggcttggtgataat
gtcgctcgatgggaccagctccatgcttctattattggaatgttggaattcaactttttt
ggcataccttacgttggagccgatatttgtgggttttttgaycacccttctgcagagatg
tgcgaacgatggatgcagcttggtgcgttttatcctttcagtaggaaccataatggcttt
ggtaataatgcacaagatcctgccgcatttggcccagacttcgcgaaatccgcacgtaaa
gttctgckcacgcgctatacactgctaccatatttgtacacgttgttctatgagtcgagg
aagtctggggctactgttgtgaggtcattgatggcagagtttacatccgataagacawct
tgggacattgatcgacagtttctatggggaccagctctgttgatatcaccagttcttgat
aagggtaaaacaagcgtrgaggcctacttccccgatgcgcgttggtatgactactatacg
ggtcaagaatcgtctcatcgtaaagagcgttcaacattggacgcgcctctagaccatatt
aacctacatgtgcgtggtggtcacgtgattcctacccaggaaccagccaataataccatg
tttagtcgtaagaacaagatggggttrataattgcactatgtgacaagcacacagcaaag
ggacagctcttttgggatgatggtgaaagcatagatacttttgaaaatggaaaatatctt
cttgacgatatctctgctgaaaagaactcagtcaaaataaaggtgtcaaaggcaggctac
gcaggggccaaaggtcttgtctggggttctgtgaagatctatggagcrggtggtgacaag
ctacgcagcgtccaagcaaatggtgytgatattaccagcaaaagctctrtctcttcaaaa
acgaaggctttaaccatcaatrgactagatttggacatcactcaaagccacgagatcaag
tgggatgtggtcacatcatcctctgcagatctaagtaaaccttggctgacactgatgtct
ctgatgacattgctttctgtctttggacgctga

DBGET integrated database retrieval system