KEGG   Exaiptasia diaphana: 110240437
Entry
110240437         CDS       T05080                                 

Definition
(RefSeq) tyrosine-protein kinase receptor torso isoform X2
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
epa  Exaiptasia diaphana
Pathway
epa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:epa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110240437
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epa01001]
    110240437
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:epa04090]
    110240437
Enzymes [BR:epa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     110240437
Protein kinases [BR:epa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   110240437
CD molecules [BR:epa04090]
 Proteins
  110240437
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Pkinase_fungal
Other DBs
NCBI-GeneID: 110240437
NCBI-ProteinID: XP_020901906
LinkDB
Position
Unknown
AA seq 812 aa
MEGDPSKSNLTTNQWFVVRGLDFRQSLNYQVIPIYKHSWIIANATSEQPVKIDPKETSLK
ITNLKHNDFTENKTLNLYSLKFTWNQPAFVKTVKHYKIXYTLKGYLGNELDCPSKRTVKR
SCLLSTTTDTSYLLKNILPKERVEFTVTPVFNNTRFVAGTEIKAPVIRAPDPQDTLVKAQ
RLNFTEIGIFKYNITWEKPLFIHSDVSYYDVSYEMYSTSGXARKRRANIETKNITANYFI
TPGVEKGMQMTVKVTPQFKDKLIAGQTSELRLGGPPIDSHPTTGFSKGETAGLVIGVLFL
VAFVLIIILLLLRSTRQKAIKEGRIVDRKKGAMIDQWEVFHDKLLLDDVIGQGAFGKVYK
GTLVELPEQSSKYSSNMXFRRKSTRRSIKEEDGYTVAVKMLQDMADEEQRKEFLKEIQLM
KDVGSHRNIVNMLGCGTLSDPMFLIVEYLPNGDLLQYLRKRRGNVHQYPDSDPRGPYHST
YLQTYFNKDKPKLVAPIQQQNNDDDDGGLQLVSIQTGVTASHDDLPSDNNMTYDDDDEDD
NITSGDLMAFAWQVSQGMEFLTRRGYVHRDLAARNVLVGENKEAKIADFGLTRHMYNSLY
QAKANRRLPIKWMSIEAIFDQSFTEKSDVWAYGIFLWELVTLGGTPYPTKSIRELLKALK
DGYRMEKPDTCDNEVYDIMLRCWEDKPEDRPTFTKIRNKLEEMMMRDNPYFDPSSVDETR
DYYNVPSFNSIEDDPEGIEDEVFDGIFGEKKEKEDQEKLVNGGCHGDSDKDDKDSEPEKH
DNESKEKPRDIGLGDIEALLYRRQYNTSSFST
NT seq 2439 nt   +upstreamnt  +downstreamnt
atggaaggggatccgtcaaaatccaatctaacgacaaaccagtggtttgttgtccgagga
cttgattttcgacaatcattaaattatcaggttataccaatctacaagcattcatggatt
attgcaaatgccacatcagaacaaccagtgaaaatagatcccaaggagacatcactgaaa
atcaccaacctaaaacacaatgattttacggaaaacaagacgctgaacctctacagcttg
aaattcacatggaatcaacctgctttcgttaaaacagtaaarcactacaaaattcrctac
acattaaagggttaccttggaaacgagcttgattgcccctcaaaaagaacagtcaagaga
tcatgtttattgtcaacaacaactgacacaagttatcttctaaaaaatattctacccaaa
gaaagagtagaatttacggtaacaccagttttcaataataccagattcgtagctggaact
gaaattaaggcccctgtcatccgcgcaccagatccccaagataccttagtcaaagctcaa
agattaaactttacagaaatcggaattttcaagtataacatcacttgggagaaaccgctg
ttcatccatagcgacgtcagctattacgatgtttcttatgagatgtacagtacgagtgga
astgcgagaaaaaggcgggcgaacatcgaaacmaaaaatattacagcgaattatttcatt
acacccggagtggaaaagggaatgcaaatgacagttaaggtgactccgcaatttaaggac
aagctgatcgctggtcaaacatcagaattgagactgggaggtcctccaatcgattctcat
cctacaacaggattttcaaagggtgaaaccgctggtcttgtcattggtgttttgttttta
gttgcgtttgtactgatwatcatcctgcttctactgcgctcgacgagacagaaagcgata
aaggagggtagaatagttgataggaaaaaaggagcgatgattgaccaatgggaggtgttc
cacgacaagctattgctagatgacgtcatcggtcagggcgcgtttggtaaagtttacaaa
ggaactttggtcgarcttccggagcaatcctccaaatacagttcgaatatgakttttagg
cgaaaaagtacacgacggtcaatcaaagaggaagatggctacacagtggctgtaaagatg
ttacaagatatggctgatgaagaacaaaggaaagagtttctgaaggaaatccagcttatg
aaagacgttggctcacatcgtaacatcgtgaacatgttgggttgtggtacactcagtgat
ccaatgtttcttatcgtggaatatctacctaatggtgatctactccagtacctcaggaaa
cgacgaggaaatgtccatcaatacccagatagcgatcctcgtggtccatatcactcaacc
tacctccagacatacttcaacaaagataaaccaaaattagtcgccccaattcaacaacaa
aacaatgacgatgatgacgggggtcttcagttagtttcgatacaaacaggcgtcactgca
tctcatgatgaccttcccagcgacaacaacatgacctatgacgacgacgatgaggacgat
aacatcacttctggtgatttgatggcctttgcttggcaggtgtctcaaggaatggaattt
ttaacaaggcgtggatatgtccatcgtgatctcgccgctcgtaatgttcttgtcggtgaa
aacaaagaagcaaagattgccgacttcggtctcacacgtcacatgtacaacagtttgtac
caggccaaggcaaatcgccgtctgccaataaaatggatgagtatcgaagccatctttgat
caaagttttactgaaaaaagtgacgtttgggcatatggtatcttcctatgggagcttgta
actctaggaggaacaccctatcctactaagagcataagggaactattgaaagcattgaaa
gatggctacagaatggagaaaccagacacttgcgacaatgaagtatatgacataatgcta
cgttgctgggaagataaaccagaagaccgtcctacatttacgaagataagaaacaaactg
gaggaaatgatgatgagagacaatccctactttgacccaagctccgtcgacgaaacacgt
gactactacaatgtcccatcattcaacagcatcgaagacgaycctgagggaatcgaagac
gaagttttcgacggaatatttggcgaaaaaaaggaaaaggaagaccaggaaaagttagtg
aatgggggctgtcatggggacagtgataaggacgacaaagattccgagccagaaaaacac
gataacgagtcaaaggaaaaaccgagggacataggtcttggtgatattgaagcgttactc
tatcggaggcagtataataccagttctttttcaacttaa

DBGET integrated database retrieval system