KEGG   Exaiptasia diaphana: 110241191
Entry
110241191         CDS       T05080                                 

Definition
(RefSeq) lysophosphatidic acid receptor 1-A
  KO
K04291  lysophosphatidic acid receptor 2
Organism
epa  Exaiptasia diaphana
Pathway
epa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:epa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110241191
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:epa04030]
    110241191
G protein-coupled receptors [BR:epa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    110241191
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 DUF3087 SRTM1
Other DBs
NCBI-GeneID: 110241191
NCBI-ProteinID: XP_020902694
LinkDB
Position
Unknown
AA seq 360 aa
MVNSTEYCAATALKKNPSVXIYVYPSVALSVIIILLNILVVAAVIKNKRLHKPAFYYVCS
LAVADFIAAVVVLFSFLRNYLHGQVIREELEITQGVFVASIGASILSLLAIAFNRFFVII
HPFNYRAKMNNTVIVVVIVIIWVYSLVLGSLPIAGWNATSTDDCSTIYPGLARTYVFVLS
LHVILALMIILGLYIAIFAKVRKSTYIIRNAXNKDERAHXKVAKTLSIVTAAFAVCWLPI
MTIGLLDMAKSITLSKYSPFFTVLAVFNSLLNPIIYASRDLEMRNTFCRILCSPSECCDR
ERHREPISDDSMTWLTACFTGSSIEEDSPRGGNEARGRVNNQAIPDNQXAKAIEEKPLNR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atggtwaactcaacggaatactgcgctgcgacagcattaaaaaaaaacccatcwgtaaks
atttatgtgtacccgtcagttgcgttgagtgtyataatcattttgttaaacattcttgtt
gttgctgctgttattaagaacaaacgtctccacaaaccagcattctattacgtgtgctct
ttagctgttgctgacttcatcgcagctgtggttgtactcttctcattcttgaggaactac
ttacatggtcaagttatcagggaagaactagaaatcacacagggtgtatttgtagccagt
attggagcatcyatcctctctcttctcgccatcgcattcaatcgtttttttgtcatcatc
catccctttaactaccgcgccaaaatgaacaacactgtgattgttgttgttatagtaata
atatgggtgtattcattggttcttggttccttacccattgctggatggaatgctacaagc
actgatgactgctccacgatttatcctggtcttgcaagaacctatgtcttcgtgctttcc
cttcatgtcattttagcactgatgattattttgggattgtacatcgctatattcgctaag
gttagaaaaagcacttatatcatcagaaatgcaaycaacaaagacgaaagagcgcatytc
aaagtygcaaagacgctgtccatagtgaccgcagcgtttgctgtctgctggcttcccatc
atgaccatcggtcttctagacatggccaagtcaatcacattaagcaagtacagccctttc
tttactgtcttggctgtcttcaactcactcttaaatcctataatatatgcgtcacgtgat
ctagagatgaggaacacattttgccgtattttatgctcaccgagtgaatgttgtgatcga
gagagacacagggaacccatcagtgatgactcgatgacttggctaacagcttgttttacg
ggaagtagcatcgaggaagatagyccgagaggcggaaatgaagcaagaggccgggttaat
aatcaagcgattccggataaccaacwagccaaagcgattgaagaaaagcctttgaaccgt
tga

DBGET integrated database retrieval system