KEGG   Exaiptasia pallida: 110245707Help
Entry
110245707         CDS       T05080                                 

Definition
(RefSeq) histone deacetylase 6-like isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
epa  Exaiptasia pallida
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:epa01009]
    110245707
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:epa03019]
    110245707
   04131 Membrane trafficking [BR:epa04131]
    110245707
   03036 Chromosome and associated proteins [BR:epa03036]
    110245707
Enzymes [BR:epa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     110245707
Protein phosphatases and associated proteins [BR:epa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110245707
Messenger RNA biogenesis [BR:epa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     110245707
Membrane trafficking [BR:epa04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    110245707
Chromosome and associated proteins [BR:epa03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     110245707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 110245707
NCBI-ProteinID: XP_020907655
LinkDB All DBs
Position
Unknown
AA seq 430 aa AA seqDB search
MSVEENLSAQIEKLNITNGNSTNTCSKRTGLVYDDRMTKHVNIWDKNHSEVPERISRPYK
KHIEYGLLERCYQIPSRSATEEELMTFHSSAHINKMKSTKDMKSRELFQLGEEYDSIYMS
EDVYECALLACGCTLEAVEHVXTNKVQNAVAIVRPPGHHADVDFAMGYCYFNNVAIAAKI
AQRKWGMNRILIVDWDIHHGNGTQSLFESDPSVLYFSIHEYHHGKFYPSSTIANHDVVGT
GKGQGFNVNVPWNKFHMGDADYLAVFQHVLLPIAHEFDPDIVLVSAGFDSARGDPKGLCD
VSPEGYCQLTNMLMGLAGGKVVVILEGGYNLTSVEESMCSCTSTLLGDPCPRLDGNQVPC
KSAMESIRDVVNSHKPFWKALEFVNIVIPVEDDKTHDCTSGKKENENTSDLEDNGDANQS
HEKHPDKLHS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtagaagaaaatctatctgctcaaattgaaaaactgaacataacaaatgggaat
tcaacaaatacatgcagtaaaaggactggtctagtttatgatgatcgaatgacaaagcat
gttaacatttgggataaaaaccattctgaagtcccagagagaatatcaagaccatataaa
aaacatattgagtatggtttgttagaaagatgctatcaaattccctcaagatctgctact
gaagaggaactcatgacttttcacagttctgctcacatcaacaagatgaaaagcacaaaa
gatatgaaatcaagggaattatttcaactgggagaagaatatgactccatttatatgagt
gaggatgtctatgaatgtgcactattggcgtgtgggtgtacgttggaagcagtggagcat
gtcrcaaccaataaggttcaaaatgctgttgctattgtaaggcctcctggccatcatgca
gatgtggactttgccatgggttactgttattttaataatgttgcaatagctgcaaagatc
gcacaaagaaaatggggaatgaacagaattttaattgtagattgggatattcaycatggt
aatggcactcaaagtctctttgaatcagatccaagtgtcctgtacttctctattcatgaa
tatcatcacggcaagttttatccatcttccactatagctaaccaygatgtrgttggaact
gggaaaggccagggytttaaygttaatgttccttggaataagtttcacatgggtgacgct
gactacttggctgtatttcaacatgtgctgctgcccatagcacatgagtttgatccagat
attgtgctagtgtcagctggctttgattctgcaagaggagatccaaagggcctttgtgat
gtcagcccagaaggctactgccagttaaccaatatgttgatgggacttgcaggaggcaaa
gttgtcgttattttagagggtgggtacaacctcacttcagtagaggagtcaatgtgcagt
tgtacatcaactcttcttggtgacccatgtccaagacttgatggaaatcaagtcccttgt
aaaagtgctatggagtctatcagagatgttgttaatagtcacaagcctttctggaaagct
ttggagtttgtcaatattgtaattcctgttgaggatgataaaactcatgattgcacttca
ggaaaaaaggaaaatgaaaatacctctgatttggaagataatggtgatgcgaaccagtca
catgaaaaacatccggacaagttgcattcgtaa

DBGET integrated database retrieval system