KEGG   Exaiptasia pallida: 110245808Help
Entry
110245808         CDS       T05080                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II alpha chain-like
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
epa  Exaiptasia pallida
Pathway
epa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:epa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110245808
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epa01001]
    110245808
Enzymes [BR:epa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     110245808
Protein kinases [BR:epa01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   110245808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like
Motif
Other DBs
NCBI-GeneID: 110245808
NCBI-ProteinID: XP_020907764
LinkDB All DBs
Position
Unknown
AA seq 313 aa AA seqDB search
MEFLCNFDVREILGKGTYSEIKRCIDRRTKADFAVKESVWRTKRERRWAENEAEILKGLD
HHNIIRLQHMYHGQQSFYLVXELASGGDLLSDIVNRPSYSEKTGREIMKQILDAVTYLHD
NXIVHRNIRPEKLLLSWKSIPDQPYPPIKLTSFGNARRLPXDRDTITCEVEGSPLYLSPE
IVTNKSIGTPVDIWACGVILYILLVGYPPFWSTQRTHLFEEIINANVTFPVSKSQSISSQ
AKELLNKMLITEPRERITAEQALQETWITDDNISTCHRKNTLDQLNVFNAKRKLKGAVFT
VFAMNRLQQSAFP
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggagttcttgtgtaactttgatgtaagggagattcttggaaagggaacctacagtgaa
ataaaacgctgtattgaccgaagaacgaaagcagacttcgctgtaaaagagagtgtttgg
cgcactaagagagaaaggagatgggcagagaatgaagcggagattttgaaaggcctggac
catcataacatcattcgcctgcaacacatgtatcatggccagcagtcgttttatcttgta
atrgagcttgcgtcaggaggagatttgctcagtgacattgtcaaccgcccctcgtactct
gaaaagactggacgagagataatgaaacagattctggatgctgtgacgtacttgcacgat
aacygtattgttcacaggaatatccgcccagaaaagcttctgctatcctggaaatcaata
ccagaccagccatacccacccataaaattgactagttttggtaatgcgaggagattacca
gmcgatagggacaccataacgtgtgaagtggaaggttctcctctttacctttcaccagag
atagttaccaacaaatccatagggacccctgttgatatctgggcctgtggagtgattctc
tatattctcttggtcggctatccacctttctggagcacgcaacgcacccacctctttgaa
gaaatcataaatgctaacgttacgttcccagtcagcaagtcgcaaagtatatcttcacaa
gcaaaagaattgctgaataaaatgcttataacagagccacgagaacggatcactgccgag
caagcattacaagaaacttggataactgacgataatatttcaacatgtcacaggaagaac
acgctggaccagttgaacgtgtttaacgcgaagagaaaactaaaaggagccgtgtttact
gtttttgctatgaacagactgcagcaatctgcttttccgtaa

DBGET integrated database retrieval system