KEGG   Exaiptasia diaphana: 110249523
Entry
110249523         CDS       T05080                                 

Definition
(RefSeq) ras association domain-containing protein 1
  KO
K09850  Ras association domain-containing protein 1
Organism
epa  Exaiptasia diaphana
SSDB
Motif
Pfam: RA C1_1 Ras_bdg_2 TUG-UBL1 FERM_f0
Other DBs
NCBI-GeneID: 110249523
NCBI-ProteinID: XP_020911757
LinkDB
Position
Unknown
AA seq 381 aa
MLALIRTGFDLLLERFRRRWGPFLWRALLILVERAVFXSLTLLGIIMEDDDVFTDPLSXQ
NGNHDYLPRELEMRARGLSGMGMRSLSLPDVSHEKGAESKSKHGQQSIMNPVKEFIVNFV
NRKAKKREAEDKSKSSAGRGHAFIPFQLRNPTWCDLCGEFIWGLYKQCVRCKNCKYTCHW
RCREEIDLDCIGHEDWRQNIARNMSIDEIAMKTLHLLDQDDPKRNEPYTMISTNISSDSL
RRKIETFNTQTTGLIMTMKDDSVFQGFIRVHMNLLRPINIVAGQRPLSIFEIVGNSVDSK
KSQRTSFFLPLGTVKALHVTSETTVQEVIEALLKKFKIADNPRKFALFECYQEQDDHVIL
RRMADIETPLMLRLLWGGADI
NT seq 1145 nt   +upstreamnt  +downstreamnt
atgttggcgctaattcgtaccggctttgatctactcttagaacgttttcgaaggcgttgg
ggaccatttttgtggcgagcactgctcattttggtcgaacgagcagtttttrgaagttta
actttgttagggatcataatggaggacgatgacgtcttcacagatcctctaagykctcaa
aatggaaatcatgattaccttcctcgtgaactcgaaatgagagcgcgagggcttagtgga
atgggaatgcgttcgctctctttaccagatgtatctcatgaaaaaggagctgaaagyaaa
tctaaacatggtcaacaatccattatgaatcccgtgaaggagtttattgttaactttgtc
aataggaaggctaaaaaacgtgaggcggaagacaaaagtaaaagtagcgctggacgaggg
cacgcgtttattcctttccaactacgaaacccaacctggtgtgacttatgtggcgagttc
atttggggcttgtataaacagtgtgttcgttgcaaaaattgtaaatatacatgtcactgg
agatgtcgtgaagaaatagacttagattgtattggtcatgaggattggcgacaaaatata
gcaagaaatatgtccattgatgaaatagctatgaaaactctacatctacttgatcaggat
gatcctaaaagaaatgaaccatatacaatgatctccacaaatatatcatctgatagtctg
agaaggaaaattgaaactttcaacacccaaaccacaggacttattatgacaatgaaagac
gactcagtgtttcaaggctttattcgtgtacatatgaatcttcttcgtccaattaatatt
gttgctggtcagagacctttatcgatatttgaaattgttggcaattctgtggatagtaag
aaaagccagagaacttcgttcttcctaccccttggtactgtcaaagctttgcacgttact
agtgaaaccacagtacaagaggttattgaggctcttttaaagaagtttaagattgcrgac
aaccctaggaaatttgctctttttgagtgttaccaagaacaagatgatcacgtgattctg
cgaagaatggctgatattgaaacaccgttgatgttgaggttgctatggggtggtgctgat
attag

DBGET integrated database retrieval system