KEGG   Exaiptasia pallida: 110250626Help
Entry
110250626         CDS       T05080                                 

Definition
(RefSeq) uncharacterized protein LOC110250626 isoform X1
  KO
K02358  elongation factor Tu
Organism
epa  Exaiptasia pallida
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:epa03012]
    110250626
   03029 Mitochondrial biogenesis [BR:epa03029]
    110250626
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:epa04147]
    110250626
Translation factors [BR:epa03012]
 Eukaryotic Type
  Elongation factors
   110250626
 Prokaryotic Type
   110250626
Mitochondrial biogenesis [BR:epa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    110250626
Exosome [BR:epa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110250626
  Exosomal proteins of breast cancer cells
   110250626
  Exosomal proteins of colorectal cancer cells
   110250626
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-GeneID: 110250626
NCBI-ProteinID: XP_020912888
LinkDB All DBs
Position
Unknown
AA seq 451 aa AA seqDB search
MLSLRLSGIKCQQLLARAAQSTRTIVSISHQRNINRTGIRVLSTPRLLVRCYAAEPSKKT
FXRBKPHVNIGTIGHVDHGKTTLTAAITKILAEKGSANFKSYGDIDNAPEERARGITINT
AHVEYETDKRHYGHVDCPGHADYIKNMITGAAQMDGAILVVAGTDGQMPQTREHLLLANQ
VGVKNIVVFVNKADVIDDPELLELVEVEMREVLTEYNYDGDNTPIIIGSALCALEEKXPD
MGINAIMKLLDAIDTHIPTPDRQLDKPFLLPIEDVFSISGRGTVVTGRIERGVVKTGDQV
EIVGHKSKIKTTVTGIEMFHKLLDXGEAGDNLGALIRGVKREDVRRGTVLCAPGSVSSHT
KFTAQVYILKKEEGGRHTPFVTNYSPQMFLRTGDVPATITLPEGSEFVMPGDNAQLTIKL
MFDMPLETGLRFTLREGGRTVGTGIVTEILE
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgctttccttgaggttatcggggataaaatgtcagcaattactcgctagagcagctcaa
agcactaggactatagtgtcaatatctcaccaaagaaatatcaacagaactggaataaga
gttctctcaactcctagattattagtaagatgttacgctgctgaaccttcaaaaaaaacc
tttrcaagarataaaccacatgttaacattggaacrattggacatgttgaccatgggaaa
actacactaactgcagccataacaaaaattttggctgagaagggatcagcaaacttcaaa
tcatatggagatattgataatgccccggaggaaagagcacgtggaataaccatcaatact
gcgcatgtygagtatgagactgataaacgtcattatggacatgtagattgccctggacat
gctgactatatcaagaacatgatcacaggagcagcgcaaatggatggagctattttggta
gttgctggaactgatggtcaaatgcctcaaaccagggaacacttattactagcaaaccag
gttggggttaaaaatattgtcgtttttgttaacaaagctgatgtaattgatgatccagag
ctattagaattggttgaagttgaaatgcgtgaggttttaactgagtacaattatgatggt
gacaatactcctataatcattggatcagctctctgtgctctagaagaaaaaarccctgac
atgggaatcaatgcaataatgaaactccttgatgccattgatacccacatcccaacccct
gacagacaacttgacaagccatttctgcttcccattgaagacgttttctcaatttctgga
cgaggaactgtagtaactggaagaattgaacgaggtgttgtaaagacaggtgatcaggtg
gagattgttggacacaaatccaagataaagacaacagttacaggtattgagatgtttcac
aaacttcttgatcraggagaggcaggtgataayctaggagctttaattcgcggtgttaaa
agagaagatgttcgtcgtggaacagtcctttgcgctcctggttcagtcagttctcatact
aaatttactgctcaagtgtatatactgaagaaagaagaaggtggtcgtcacactcctttc
gttactaactactcccctcagatgtttctccgtactggtgatgtacctgccaccatcacc
ctccccgaggggagtgaatttgttatgcctggcgataatgcccagttgaccatcaagttg
atgtttgacatgccgttagagaccgggcttcgattcacgctaagagagggaggcaggacg
gtggggactggtatagtaactgaaatcttagaatga

DBGET integrated database retrieval system