KEGG   Exaiptasia pallida: 110250932Help
Entry
110250932         CDS       T05080                                 

Definition
(RefSeq) glutathione S-transferase U25-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
epa  Exaiptasia pallida
Pathway
epa00480  Glutathione metabolism
epa00980  Metabolism of xenobiotics by cytochrome P450
epa00982  Drug metabolism - cytochrome P450
epa00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    110250932
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    110250932
   00982 Drug metabolism - cytochrome P450
    110250932
   00983 Drug metabolism - other enzymes
    110250932
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epa02000]
    110250932
Enzymes [BR:epa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     110250932
Transporters [BR:epa02000]
 Other Transporters
  Pores ion channels [TC:1]
   110250932
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C GST_C_2 GST_N_4 GST_C_3 Glyco_transf_88 VapB_antitoxin RmuC GST_C_5
Motif
Other DBs
NCBI-GeneID: 110250932
NCBI-ProteinID: XP_020913251
LinkDB All DBs
Position
Unknown
AA seq 236 aa AA seqDB search
METVPKFYNAWFCPFAQRAWIALIAKKVKFEYIEQNPYNKTPEWMSISPTGLVPVILHEG
STIYESGVCIEYIDEAFNTDVSLMPKDPAKRAYARIWGDFLGKKVIPNFYAMLLKQNKDE
QEEAKEKYLQGLKEFTKAMSPKFSYFQQGTISYVDIMFAPFAQRTDWILKHFRGFEIPKT
PDMERYHKWWETVKRHPAFIDTLCDEEKLIEVYQRYAHNTTRSLVAEAIRKGQPLP
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atggaaactgtkccaaagttttacaatgcatggttctgcccctttgcacagcgtgcatgg
attgctttaatagcaaaaaaggtcaaatttgaatatattgaacaaaacccttacaacaag
acaccagaatggatgtcaatcagyccaactggacttgtaccagttatactccatgaagga
agcacaatctatgaaagtggtgtttgcattgaatacatcgatgaagccttcaacactgat
gtctcactcatgcctaaagacccagctaaaagggcttatgctcgyatatggggagatttt
ytgggaaagaaagtmattccgaacttttatgcaatgttgctgaagcaaaataaagatgaa
caagaggaagctaaagaaaaatatctccaaggtttaaaagaattcaccaaagcaatgtca
cccaaattttcctacttccagcaaggaactatcagctatgttgacattatgtttgcacca
tttgcgcaacgcacagattggattttaaagcatttcagaggatttgaaatccctaaaact
cctgatatggaacgctaccataagtggtgggaaactgtgaagagacatccagctttcatt
gacacactttgtgatgaagagaaattgattgaagtctatcaacgttatgctcacaacacg
acaaggtcacttgttgctgaagcaatccgcaagggacaacctcttccttaa

DBGET integrated database retrieval system