KEGG   Exaiptasia diaphana: 110251784
Entry
110251784         CDS       T05080                                 

Definition
(RefSeq) fibroblast growth factor 7
  KO
K18496  fibroblast growth factor 1
Organism
epa  Exaiptasia diaphana
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:epa04052]
    110251784
   00536 Glycosaminoglycan binding proteins [BR:epa00536]
    110251784
Cytokines and growth factors [BR:epa04052]
 Growth factors
  Growth factors (RTK binding)
   110251784
Glycosaminoglycan binding proteins [BR:epa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   110251784
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110251784
NCBI-ProteinID: XP_020914181
LinkDB
Position
Unknown
AA seq 197 aa
MLVSCKTYLTIVFTFSLFPNSFESSPNRTNVDRKLAQLCGAKIRXPKTKLKLNHEIFNVN
TNSSPTHVRLIRLYSRTGYLMEVWDKKRIRGTTDTRSNRTWFELQSYGRSIVRLRSKKTG
RYLAINWRGRPTMQIHRKTDSLFRTKLEDNGFHSFTSHKYYSRXRHDLFLGIKKNGSFKS
PLSTLPGQKSVQFLVLE
NT seq 594 nt   +upstreamnt  +downstreamnt
atgttagttagctgtaagacctatctgactatagtattcacattcagtctcttcccaaac
tccttcgaatcaagtccaaacagaaccaacgtggaccggaaactagcccaattatgtggc
gcgaaaatcagagyacccaagacaaaattaaaacttaaccatgagatatttaacgtgaat
acaaactcaagtccaacacacgtgagactgatcagactttacagtaggacgggttatctg
atggaagtttgggacaagaaaaggattcgaggaacaacggatacaaggagcaatcgaacg
tggtttgaacttcagtcatacggtcgtagtattgtacgattaagaagcaagaaaaccggc
cgttacctggcaataaactggcgaggaagaccaaccatgcagatccatcgaaaaacggac
agtctgtttaggacaaaactagaggacaacggttttcacagcttcacatctcacaagtac
tacagtcgcyatcgtcacgacctttttcttggcatcaagaaaaatggatcctttaaatcc
ccgttatctactctacctggacaaaaatccgtacagtttttggtgctagaatag

DBGET integrated database retrieval system