KEGG   Exaiptasia diaphana: 110251813
Entry
110251813         CDS       T05080                                 

Definition
(RefSeq) fibroblast growth factor 9 isoform X2
  KO
K18496  fibroblast growth factor 1
Organism
epa  Exaiptasia diaphana
Brite
KEGG Orthology (KO) [BR:epa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:epa04052]
    110251813
   00536 Glycosaminoglycan binding proteins [BR:epa00536]
    110251813
Cytokines and growth factors [BR:epa04052]
 Growth factors
  Growth factors (RTK binding)
   110251813
Glycosaminoglycan binding proteins [BR:epa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   110251813
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 110251813
NCBI-ProteinID: XP_020914214
LinkDB
Position
Unknown
AA seq 186 aa
MASSKRYRRKKNTGSSIKANYGIKIYYPKRPKWPSPRINVNWESIYELTKKPTNRVLCKI
FCRSGYHVQILSNGVVRGTVNQSSKYVVFEMQSFGPSLVKIKSIATGRXLSMKRDGTLKA
TRHANTKETIFKETHEMNAFHSYASHKYFRGKPHDMLVGIKRNGQVKKATRTKHGMTATQ
FLVIKD
NT seq 561 nt   +upstreamnt  +downstreamnt
atggcttccagcaaaagatatcgcagaaaaaagaatacaggatcttctatcaaagcaaat
tatgggataaagatttactaccctaaaagaccaaaatggccatcaccacgaataaacgtc
aactgggagagtatctacgaattgacaaagaaacccacaaatcgcgtcctgtgtaarata
ttttgtagaagtggatatcacgtgcaaatattatccaatggtgtagttcgtgggactgtc
aatcagagcagtaaatatgttgtatttgagatgcagtcgtttggaccaagtcttgtcaag
ataaagagtatagcaactgggcgatamctctccatgaaacgagacgggactttaaaagca
acgcgtcacgctaacacaaaggaaactattttcaaagaaacacatgagatgaacgcgttt
cattcttatgcctcccacaagtactttcgcggcaaacctcacgatatgttggttggaatc
aaacgaaatggtcaagtgaagaaagctacaagaaccaagcatggcatgaccgccactcaa
ttccttgttataaaggactag

DBGET integrated database retrieval system