KEGG   Exaiptasia pallida: 110253421Help
Entry
110253421         CDS       T05080                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial-like
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
epa  Exaiptasia pallida
Pathway
epa00010  Glycolysis / Gluconeogenesis
epa00053  Ascorbate and aldarate metabolism
epa00071  Fatty acid degradation
epa00280  Valine, leucine and isoleucine degradation
epa00310  Lysine degradation
epa00330  Arginine and proline metabolism
epa00340  Histidine metabolism
epa00380  Tryptophan metabolism
epa00410  beta-Alanine metabolism
epa00561  Glycerolipid metabolism
epa00620  Pyruvate metabolism
epa01100  Metabolic pathways
Module
epa_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:epa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    110253421
   00053 Ascorbate and aldarate metabolism
    110253421
   00620 Pyruvate metabolism
    110253421
  09103 Lipid metabolism
   00071 Fatty acid degradation
    110253421
   00561 Glycerolipid metabolism
    110253421
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    110253421
   00310 Lysine degradation
    110253421
   00330 Arginine and proline metabolism
    110253421
   00340 Histidine metabolism
    110253421
   00380 Tryptophan metabolism
    110253421
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    110253421
Enzymes [BR:epa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     110253421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DtxR
Motif
Other DBs
NCBI-GeneID: 110253421
NCBI-ProteinID: XP_020915987
LinkDB All DBs
Position
Unknown
AA seq 524 aa AA seqDB search
MALRLAATIPRAIFRATLPSVTRLCKLSALAQEAVDDNPEVKYNKVFINNNFVDSVSGKT
FPTINPSTGEKICDVAEGDKADVDVAVXAAQQAFQLGSPWRTMDASDRGRLLYKLADLIE
RDRAYLASLESLDNGKPYXDSFNVDLDLVIKCYRYYAGWADKVHGKTIPLDGPFMCYTRH
EPVGIVGQVIPWNFPLLMQAWKLGPALACGNVVVMKPAEQTPLTALYVASLIAEAGFPAG
VVNLVPGYGPTAGGAIAGHMDVDKIAFTGSTEVGHIIQKTAAESNLKNVTLELGGKSPNI
VLADTDVNFAVEMSHFALFFNQGQCCCAGSRTFVEESIYDEFVEKSVQRAQNRSVGNPFD
LKNEQGPQVDEEQFNKILNLIESGKNEGAKLEVGGGRAGDKGYFIQPTVFSGVEDHMTVA
REEIFGPVMQIFKFKDMDDILHRANKSIYGLAGSIMTNNLEKALMLSNGLRAGTIWVNCY
DALSAQAPFGGYKMSGIGRELGEYGLQQYSEVKTVTIKLPQKNS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atggctcttcgtctggctgcaactattccaagggctatcttcagagcaactcttccatca
gtgactagactgtgcaaactctcagctcttgctcaggaagcagttgatgacaatcctgag
gtgaagtacaataaggtctttatcaataacaactttgtggattctgtgagtggaaagaca
tttccaactatcaatccatcaactggtgaaaagatctgtgatgtagctgaaggagacaaa
gctgatgtggatgttgctgtcmaagctgcccaacaagcttttcagcttggaagtccttgg
agaactatggatgcttcagacagaggaaggctcttgtacaaacttgctgacctgattgag
agggacagggcatatctagctagtctagagtctctggacaatggcaagccctacartgat
tccttcaatgttgatttagacctggttatcaagtgttatcgctattatgcaggctgggca
gataaagtgcatggcaaaactattccattagatgggccttttatgtgctacactcgacat
gaaccagttggaattgttggccaagttattccatggaatttcccactgttaatgcaggct
tggaagcttggyccagctcttgcatgtggcaatgtggtagtaatgaaaccagcrgaacag
actccactcactgctttgtatgtggcttctttgattgcagaggcaggttttccagctggt
gtagtaaaccttgtcccagggtatggtcctactgctggtggtgcaattgctggtcacatg
gatgttgacaagattgcgtttactggatctactgaggttgggcacatcattcagaaaaca
gcagctgaaagcaatttgaagaatgttacactagagcttggtggcaagagtccaaacatt
gtccttgctgacactgatgttaactttgctgttgagatgagtcattttgctttgtttttc
aaccaaggacaatgctgttgtgctggcagccgtacctttgttgaagagtctatctatgat
gagtttgtggagaagagtgtgcaaagagctcagaatcgttctgtggggaacccttttgac
ttgaaaaatgaacaaggaccacaggttgatgaagagcaattcaacaaaatcttgaacctg
attgaatctggaaaaaatgaaggagcaaaactagaggttggaggtggtagagcaggtgac
aaagggtacttcatccagccaaccgttttctcaggtgttgaagatcacatgacagttgcc
agggaagagatttttgggcctgtgatgcagattttcaagttcaaagacatggatgacatt
ttacatagagcaaacaaatcaatttatggtctggcaggatctattatgaccaacaacctt
gagaaagctttgatgttgtcaaatggtctacgtgctggtacaatatgggtgaattgctat
gatgctcttagtgctcaagcaccatttggtggctacaaaatgtctggaattggyagagaa
ctgggtgaatatggcttgcagcagtactctgaagtcaaaacagtcaccataaaactaccc
cagaagaattcctaa

DBGET integrated database retrieval system