KEGG   Exaiptasia diaphana: 110254510
Entry
110254510         CDS       T05080                                 

Definition
(RefSeq) TGF-beta receptor type-2 isoform X1
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
epa  Exaiptasia diaphana
Pathway
epa04068  FoxO signaling pathway
epa04144  Endocytosis
epa04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:epa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    110254510
   04068 FoxO signaling pathway
    110254510
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110254510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:epa01001]
    110254510
Enzymes [BR:epa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     110254510
Protein kinases [BR:epa01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   110254510
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 110254510
NCBI-ProteinID: XP_020917183
LinkDB
Position
Unknown
AA seq 512 aa
MFFFLPVILXGVNGTRYCMSCNAVCNTKSASCTKCPKMKLEKCQQNTDICIASWTPTYKG
TGMLAMCFPLPPQEDRIKYSKICKPWNRNGTYTCLCRRNGCNKVPLLTTTSVPSTTRSPK
ITSDGLVALSTQKTKSNPYTSGHSKAPSCSVRCIAIXCSLLILLLLILGMYVAAKRSSKH
RKSFPVNDVSPMKTKKVSAITLLPHSLPELKIKIAEGNKCAVWRGTFSGIDVAVKCFSVE
KECLWTNERRIYSNCYVHHKNIAVLVAXSNPLTNGGNQIWLATKYCEQGTLQSYLKSHDL
SWERLLXMAKDITAGLGFLHKDCLYXGRGHKAAIAHQDLKSKNVFIEGDGTCVIADFGLS
LELTKDYSRQLYRDGQVGTVRYMAPEKLEARFDIADPDSFKQIDVYALALILWEMLARCQ
LGQGQSTCMDYTLPYQDLVGNHPTLAEMIDVVSENGCRPRKPKLLMDKSTPNDVHHLWTT
ITECWDEDPEARLTADCVSLRLDNLYCKSVLN
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtttttcttcttaccagtaattttattkggtgtcaatggcacacggtattgtatgtcc
tgcaacgctgtgtgtaacacaaaaagtgccagttgtacgaaatgtcccaaaatgaagctg
gaaaaatgtcaacaaaacactgatatttgcatcgcatcgtggactccgacttacaaaggg
acagggatgctggctatgtgctttccccttcctcctcaggaagacaggatcaaatacagc
aaaatttgtaaaccgtggaacagaaatggaacctacacatgcttatgccgaagaaatgga
tgtaataaagttcctttgttgactactactagtgttccttcaactacaagatcaccaaag
atcactagcgatggcctcgtagctctcagtacacaaaaaacaaaatcaaayccatatacc
tcaggacacagcaaagcaccttcatgttcagtgcgatgcatcgccattttwtgttcattg
ttaatcttgctcctgctcatacttggaatgtatgttgctgccaagagaagctccaaacac
cgaaaatcattcccagtgaacgacgtctctcccatgaagacaaaaaaagtttcagcgatc
actttactaccacacagccttccggaactcaaaatcaagatcgctgaaggaaataaatgt
gctgtatggagaggaactttcagtggaattgacgttgcagttaaatgtttttcagtggaa
aaggaatgtttatggaccaatgaacgccgtatttattccaattgctatgtccatcataaa
aatattgctgtcttggtggcckcaagtaatccattraccaatggcggaaaccaaatatgg
ctagctactaaatactgcgagcagggtacactccagagttatcttaaatcacaygatctg
agttgggaaagrttgctgrccatggcaaaagacataactgcaggcttaggttttctacac
aaggactgcctttaccyagggagaggacataaagctgctattgcacaccaagatctcaaa
agcaagaatgtattcatagagggkgatggaacttgcgtcattgctgattttggtctatcc
ttggaattaacgaaggactactcgcggcagttgtatcgtgacggacaagttgggactgtt
cgttacatggcaccagagaaactggaagcacgatttgacatcgcagatccggattccttt
aaacagattgacgtttatgcccttgctcttattctgtgggaaatgctagcacgttgtcag
ttaggacaaggacaaagcacgtgtatggattacacgctgccttaccaagatctcgttgga
aatcacccaacacttgctgagatgatagatgtggtctcagaaaatggctgtaggccaagg
aagccaaaactattgatggacaaatcaacgccaaatgacgtgcatcatctttggaccaca
atcactgaatgctgggacgaagatccagaagctcgtcttactgcagactgtgtgtcatta
cgactagataatctttactgcaaatcagtgttaaactga

DBGET integrated database retrieval system