KEGG   Exaiptasia pallida: 110254613Help
Entry
110254613         CDS       T05080                                 

Definition
(RefSeq) DNA ligase 4-like
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
epa  Exaiptasia pallida
Pathway
epa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:epa00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    110254613
Enzymes [BR:epa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     110254613
DNA repair and recombination proteins [BR:epa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     110254613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C BRCT_2 BRCT DNA_ligase_IV RNA_ligase mRNA_cap_enzyme LIG3_BRCT PTCB-BRCT
Motif
Other DBs
NCBI-GeneID: 110254613
NCBI-ProteinID: XP_020917283
LinkDB All DBs
Position
Unknown
AA seq 924 aa AA seqDB search
MAASSGGSCVAAEVPFRDLCGLLEKISSTSGTEKKRNLLSKFIDAWRGAHTKIHGDSKTT
DSLYPAIRLLLPQLDKDRSAYGMKEVVLAKYYIEILSISKDSVDGRKLLNYRNPGATKQG
LATDFASVAYFVLRSRCPTQGSLNVEQVNKYLDDIAQANLVKKRDEIKKTLQILLRNTNA
IEQKWLIRIILRDLKTGLSENSVLGVFHPDALELYNICNSLMKVCQDLHDRSIRMNEVEI
TLFSPFRPMLGQRGSLDEIEKLMEHQTFYIEEKVDGERMQLHKDGNNYKYYSRSANEYTH
VFGANSKDGYLTPHIADYFDSSTKSCILDGEMVVFDTENDVFLTKATNLDVKSDSTYNKG
HHPCFIVFDILLLNGKKLANVPLMERLSSLTKVFKSRPGYIQCVDRKSATTKAEVLSALN
DAIDRREEGLVIKSPNSVYKPNVRNGSGWLKIKPEYVDSLSEDLDVLIMGGYFGVGRRSG
MVSHFLCGVAVPPDHRGQHPNQFYSFCKVGTGYTLNELKELGQKLKPHWQPFKTNKPPTS
IILASGFKEKPDVWIEPSKSVIVQVKATEIIASERFKAGVTLRFPRLECVRDDKKWYDCL
DVKELHKLRTIAQGKLTHQHTNPDDTSQQPSRKKRRVAPRIEQPRAVAAQFRPADVSSVI
EVSKLFDGKEFCVINGPSTHSKSILEKKIVEHGGTFTQNPGPETFCVVADRLNLRVNNII
KDAKYDVVKACWLVDCLDRKTLLPWLPSHMFHSSPSTEKQFAMEYDCYGDSFTQDATVDS
LKKAFNDFDKDDTAPNHAITLDEIAEIEQRYYPGDSPLGLFRPCRVYLDQYKNIDDSTTG
IKDCSLEVTALELRMYGASISKEFDENVTHVVVDIRDLSRXHQLRTKMRSRHQKHHIVSQ
DWVSQSIEQQKLQQELLHSVQLDT
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggcggcttccagtggaggtagttgtgttgctgctgaagttcccttccgtgacttgtgc
gggttgttggagaaaatatccagcacaagtggaacagaaaagaaaagaaatttattgagt
aaattcattgacgcttggagaggagcgcataccaaaattcatggtgattcaaaaacgaca
gactccctatatccagcaataagactactactgcctcaacttgataaggacagatcagca
tatggaatgaaagaggttgttcttgcaaagtattatattgaaatactcagcataagcaaa
gacagtgttgatggccggaaactactgaattatcgcaatcctggagcaacaaagcagggt
ttggctactgactttgccagtgtagcatattttgttcttagaagtagatgtccaacccaa
ggaagtttaaatgttgagcaagtcaacaagtaccttgatgatattgcacaagcaaatttg
gtcaagaaaagagatgaaattaaaaaaactttgcaaattttgctaagaaataccaacgct
attgaacagaaatggcttatcaggatcattctaagagatcttaaaactggtttaagtgag
aactcagtccttggtgtgtttcatcctgatgctcttgagctgtacaatatttgtaacagt
ctaatgaaggtttgtcaagaccttcatgatcgttccatcaggatgaatgaagttgaaatt
acacttttctcaccatttcgaccaatgctaggtcagagaggctcattggatgagattgag
aagctgatggagcaccaaactttctatatcgaagagaaagttgacggagagcgaatgcag
cttcataaagatggcaacaactacaaatattactccagaagtgctaatgagtacactcac
gtatttggtgcaaactctaaagatggttacctaactcctcacattgctgactactttgac
agttcaaccaagtcatgtattctagatggggagatggttgtttttgacactgaaaatgat
gtgtttttaaccaaagcaacaaatctggatgtcaaatcagactcaacatataacaaaggt
catcacccatgtttcattgtgtttgacattctccttctgaatggaaaaaagctggcaaat
gtgccgttaatggaaagactgtcatcactgaccaaggtgttcaagtctcgaccaggttat
atccagtgcgttgacaggaaaagtgctaccacaaaagctgaagtacttagtgctcttaat
gacgctattgatcgacgtgaggagggtttagtcatcaaatcaccaaactctgtttacaaa
cctaatgtcagaaatggaagtggttggttgaaaatcaagccagagtatgtggatagcttg
agtgaagatcttgatgttcttataatgggtggttattttggagttgggcgtcgaagtggt
atggtatctcatttcctgtgtggtgtggctgtcccaccggaccatcgaggtcaacatcca
aaccagttttattcattctgtaaggttggtactgggtacacgctaaatgaactgaaagaa
cttggtcaaaagttaaaaccacattggcagccgtttaagaccaacaaaccaccaacaagt
ataatactggcatctggattcaaagaaaagccagatgtatggattgagccgtccaagtca
gtgattgtacaggtcaaagccactgaaatcattgcttcagaaaggttcaaggcaggagtg
actttgaggtttccaaggttggaatgtgtgcgagatgataaaaaatggtatgactgcctg
gacgtaaaagaactacacaagttacgaacaatagctcaaggaaagcttacacatcaacac
acaaaccccgatgacacatcccaacaaccttcacgtaagaaaagacgcgtggccccgcgc
attgaacaacctcgcgctgttgcggcgcagtttcgacctgcagacgtgtcttctgttata
gaggtatcaaaactttttgatggcaaggagttctgtgttataaacggaccatctactcac
tcaaaatccattcttgagaagaaaattgttgagcatggagggacattcacacagaatcct
ggtcccgagacattttgtgttgtggcagataggctcaacttacgggtcaataatatcatc
aaagatgctaaatacgatgttgttaaggcttgttggctggtagattgcctggatcgaaaa
acgctgttaccttggttacctagtcacatgttccattcctcgccatccaccgagaagcag
tttgctatggaatacgattgctatggtgacagctttacacaagatgcaacggtggattcc
ttgaaaaaagcctttaatgactttgataaagatgataccgccccaaaccatgccatcact
cttgacgagattgccgagatagaacaacgttattatccaggcgattctccccttggttta
tttagaccatgtcgtgtatatttggatcaatataaaaacatagatgacagcaccacgggc
atcaaggactgtagtttagaggtaacagcacttgaactgcgcatgtacggcgcatcaata
agtaaagaatttgacgaaaatgtcactcatgtggtcgtagacataagagatctctctcga
akccatcaactgcgtactaagatgaggagtcgccatcaaaaacaccatatcgtcagccaa
gactgggtatctcaaagtattgaacaacagaagttacaacaagaactccttcactctgta
caattggatacatag

DBGET integrated database retrieval system