KEGG   Erwinia persicina: CI789_04320Help
Entry
CI789_04320       CDS       T05618                                 

Definition
(GenBank) hypothetical protein
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
epe  Erwinia persicina
Pathway
epe00040  Pentose and glucuronate interconversions
epe00051  Fructose and mannose metabolism
epe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CI789_04320
   00051 Fructose and mannose metabolism
    CI789_04320
Enzymes [BR:epe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     CI789_04320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AXU94530
LinkDB All DBs
Position
939971..940951
Genome map
AA seq 326 aa AA seqDB search
MSELKFATRLNSFASGAWRYWPELKGKPSVLQMIERAATAKGLTHLDLNYPQHITDDVKT
MRQKIEDVGLAVNGMQMRWDAPEFKIGAYTNPDAKIRRQAIELTKRGIDAGREFGASIMT
LWMGQDGFDYCFQVDYKKVWEDAVSAVREVAEYAGDMDVSIEYKPNEPRAFAIFPNVTTC
LLAVEEAGCPNLGITLDFAHVLYANEIPAYAAAMVARRSRLLGLDLNDGWGKRDDGLMAA
SVNPRATLEFLWQMKRDGYKGAYYFDTFPDASGLDPVREAETNIATVTRLLRLCDKLDNN
PALLDAISRQDAVTSQQIVNDIMLAP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaactgaaatttgctacccgcctcaactcctttgcgtccggcgcgtggcgctac
tggccagagctgaaaggcaagccttccgttttgcagatgattgagcgtgcagctacggcg
aaaggcctgacccatctggatctgaactatccgcagcacatcaccgatgatgtcaaaacc
atgcgtcagaaaattgaagacgtggggctggcggtgaacggcatgcagatgcgctgggat
gcaccggaatttaaaatcggcgcgtataccaacccggatgccaaaatccgtcgtcaggcg
atcgaactgaccaagcgcggtattgatgccggacgcgaatttggtgccagcatcatgacg
ctgtggatggggcaggacggttttgattactgcttccaggtcgactacaaaaaagtctgg
gaagatgcggtcagcgcggtgcgtgaagtggcggaatatgccggggatatggacgtcagt
attgagtacaagcccaacgaaccgcgggctttcgccattttcccgaacgtcaccacctgc
ctgctggcggtggaagaagccggctgcccgaatctgggtatcaccctcgactttgcccac
gtgctgtatgcgaatgagatcccggcctatgccgccgccatggtggcccgccgttcacgc
ctgctcggcctcgatctgaacgacggctggggcaaacgcgatgatggtctgatggccgct
tccgttaacccgcgcgctacgctggagttcctctggcagatgaagcgtgacggttataaa
ggcgcttactattttgacaccttcccggatgccagcggtcttgacccggtgcgtgaagcg
gaaaccaacattgccaccgttacccgtttactgcggctctgcgacaagctggataataac
ccggccctgctggacgccatcagccgccaggatgccgttacctctcagcagattgttaac
gacattatgctggcaccttaa

DBGET integrated database retrieval system