KEGG   Erwinia persicina: CI789_04495Help
Entry
CI789_04495       CDS       T05618                                 

Definition
(GenBank) butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
epe  Erwinia persicina
Pathway
epe00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CI789_04495
Enzymes [BR:epe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CI789_04495
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CI789_04495
    1.1.1.-  
     CI789_04495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C TrkA_N Shikimate_DH ADH_zinc_N_2 F420_oxidored 2-Hacid_dh_C NTP_transf_3 Methyltransf_24 ApbA
Motif
Other DBs
NCBI-ProteinID: AXU94558
UniProt: A0A3S7S1V3
LinkDB All DBs
Position
complement(985632..986687)
Genome map
AA seq 351 aa AA seqDB search
MKAARWYKAHDIRIDDIEEPQVSAGKVKIKVAWTGICGSDLHEYLAGPIFVPVGKPHKIS
HDIAPIVMGHEFSGEVVEVGAGVSKFKAGDRVVVEPILACRECEACREGKYNLCGDLGFH
GLSGGGGGFSSFTMVDEHMVHRMPDGLSYEQGALVEPAAVALHAVRMSKLKAGDKAAVFG
AGPIGLLVIEALRAAGASEIYVVELSPQRAEKARELGANVVIDPGKQDAVATIRELSKGG
VDVSFEVTGVPVVLKQCIDATRYEGETIIVSIWEGEASFHPNRVVLAERSVKGIIAYRHI
FPAVMELMTQGYFQADKLVTKRIELNDLVTEGFDALVKEKNQVKILVRPPQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgttggtataaagcacatgacatccgcattgacgatatcgaagagcct
caggtttcagccggtaaggtgaaaatcaaagtggcctggaccggcatctgcggcagcgat
ctgcacgaatacctcgccggcccgatctttgttccggtcggcaagccgcacaaaatcagc
cacgacattgctcctatcgtgatgggccacgagttctcgggcgaagtggttgaggttggt
gctggcgtcagtaaatttaaagcgggcgaccgtgtggtggtcgagccaatccttgcgtgc
cgcgaatgtgaagcctgccgcgagggcaaatacaatctgtgcggcgacctgggcttccac
ggtctgtccggcggcggtggcgggttctcgtcatttaccatggtcgatgagcatatggtg
caccgcatgccggacggtctgtcttacgaacagggcgcgctggtggaacctgccgccgtg
gccctgcatgccgtgcgcatgagcaaactgaaagccggggataaagcggcggtatttggt
gccggcccgattggtctgctggtgatcgaagccctgcgtgcggcgggagcctcggagatt
tacgtcgtcgagctgtcgccgcagcgcgccgaaaaagcccgcgagctgggggctaacgtg
gtcatcgacccgggcaagcaggatgcggtagccaccatccgtgaactgagcaaaggcggc
gttgacgtgtcgttcgaagtgaccggcgtgccggtggtgctgaagcagtgtattgatgcc
acccgctacgaaggcgaaaccatcatcgtttccatctgggagggtgaagcctcgttccac
ccgaacagggtggtactggccgaacgcagtgtgaaaggcatcatcgcctatcgccatatt
ttcccggcggtgatggagctgatgacccaggggtatttccaggccgacaagctggtcacc
aaacgcattgaactgaacgatttggtgaccgaagggttcgacgcgctggtgaaagagaaa
aaccaggtgaaaatcctggtccgtccaccgcagtaa

DBGET integrated database retrieval system