KEGG   Erwinia persicina: CI789_08820Help
Entry
CI789_08820       CDS       T05618                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
epe  Erwinia persicina
Pathway
epe00480  Glutathione metabolism
epe01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CI789_08820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:epe02000]
    CI789_08820
Enzymes [BR:epe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CI789_08820
Transporters [BR:epe02000]
 Other transporters
  Pores ion channels [TC:1]
   CI789_08820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C_6 Tom37 GST_N_5
Motif
Other DBs
NCBI-ProteinID: AXU95323
LinkDB All DBs
Position
1921252..1921857
Genome map
AA seq 201 aa AA seqDB search
MKLFCKPGACSLSPHIVLRESGFDFTLVTVDTQSKKTEQDEDYLLINPKGQVPALQLDDG
SVLTEGVAIVQYLADLKPDRQLLAPSGSLTRYHTLEWLNFIATELHKGFSPLFRPTTPEE
YKAIAREQLEQKFHYVNTELKEKQWLMGLRFTVADAYLFTVTRWAHTLRLNLSELEALNA
WFERVAARPAVAAALSAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttctgtaaaccgggtgcctgttcactgtcaccccatattgtcctgcgcgaa
tccggttttgatttcaccctggtgacggttgatacccaatcgaagaaaacagaacaggat
gaagactacctgctgattaaccccaaaggacaggtgcctgcactgcagttggatgatggc
tcagtgctgaccgaaggggtggcgattgttcagtaccttgccgatctgaaacccgatcgc
cagctgctggccccttccggtagcctgacacgttaccatactctggagtggctgaacttt
attgccacggaactgcacaaagggttcagcccgctgtttcgccccacgacgccggaggaa
tataaggctatagcccgggagcaactcgagcagaaattccactacgtgaataccgaatta
aaagagaagcagtggctgatggggttgcgatttacggtggcggatgcctatctctttacc
gttacgcgctgggcacacacgctcaggctgaacctgagtgaactggaggcattaaacgca
tggtttgagcgggttgccgcgcgtcccgccgttgcggctgcactgagtgccgaagggctg
aactga

DBGET integrated database retrieval system