KEGG   Erwinia persicina: CI789_10935Help
Entry
CI789_10935       CDS       T05618                                 

Definition
(GenBank) bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
epe  Erwinia persicina
Pathway
epe00061  Fatty acid biosynthesis
epe01100  Metabolic pathways
epe01212  Fatty acid metabolism
Module
epe_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:epe00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CI789_10935
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:epe01004]
    CI789_10935
Enzymes [BR:epe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CI789_10935
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     CI789_10935
Lipid biosynthesis proteins [BR:epe01004]
 Fatty acid synthase
  Component type
   CI789_10935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA
Motif
Other DBs
NCBI-ProteinID: AXU95697
UniProt: A0A3S7S4J2
LinkDB All DBs
Position
2333259..2333777
Genome map
AA seq 172 aa AA seqDB search
MVDKRESYTKEDLIASGRGELFGAEGPPLPAGNMLMMDRVVKMTEDGGNYGKGFVEAELD
INPDLWFFGCHFINDPVMPGCLGLDAMWQLVGFYLGWLGAEGKGRALGVGEVKFTGQVLP
TAKKVSYRIHFKRVINRKLVMGVADGEVLVDGNVIYTATDLKVGLFKDTTAF
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atggtagataaacgcgaatcctatacaaaagaagacctgattgcctctggtcgcggtgaa
ttatttggcgcagaaggcccgccattgccagccggcaatatgttgatgatggaccgcgtg
gttaagatgaccgaagacggcggtaactacgggaaaggattcgttgaagcggaactggat
atcaatcccgatctgtggttcttcggctgtcattttatcaatgacccggttatgcccggc
tgcctcggcctggatgctatgtggcagttggtcggtttctacctcggctggttaggcgct
gaaggtaaaggccgcgcactgggcgtgggtgaagtgaaattcaccgggcaggttctgcca
acagccaaaaaagtttcttaccgcatccatttcaaacgcgttattaaccgtaaactggtg
atgggcgtggcagatggtgaagtactggtcgatggtaacgtgatttacactgctaccgac
ctgaaagtgggcctgtttaaagacaccactgctttctaa

DBGET integrated database retrieval system